seo site checkup logo
PricingFree ToolsArticles
Report generated 8 years ago
https://pratamaantenatvdigital.blogspot.co.id
Your general SEO Checkup Score
Archived
69/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 69 out of 100, which is below the average score of 75. However, there are 11 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
11 Failed
0 Warnings
30 Passed
Common SEO issues
Score: 53
Failed: 5
Warnings: 0
Passed: 10
Google Search Results Preview
Desktop version
https://pratamaantenatvdigital.blogspot.co.id/TOKO || JASA ANTENA TV DIGITALjasa pasang antena tv,agen pasang antena tv,ahli pasang antena tv,pasang antena tv,toko antena tv,toko pasang antena tv,pasang parabola,jasa pasang parabola,ahli pasang parabola,toko pasang parabola,agen pasang parabola,toko parabola,pasang antena tv jakarta, pasang antena tv tangerang, pasang antena tv Serpong, pasang antena tv depok, pasang antena tv bintaro, pasang antena tv bogor, pasang antena tv bandung, pasang antena tv kelapa gading, pasang antena tv digital, ahli pasang antena tv, ahli pasang antena tv semarang, ahli pasang antena tv lokal, ahli pasang antena tv di banten, ahli pasang antena tv bekasi, ahli pasang antena tv bogor,agen ahli pasang antena tv,jasa ahli pasang parabola, parabola murah, parabola murah bandung, parabola murah, parabola murah bogor, pasang parabola Serpong, parabola murah tangerang
Mobile version
https://pratamaantenatvdigital.blogspot.co.id/TOKO || JASA ANTENA TV DIGITALjasa pasang antena tv,agen pasang antena tv,ahli pasang antena tv,pasang antena tv,toko antena tv,toko pasang antena tv,pasang parabola,jasa pasang parabola,ahli pasang parabola,toko pasang parabola,agen pasang parabola,toko parabola,pasang antena tv jakarta, pasang antena tv tangerang, pasang antena tv Serpong, pasang antena tv depok, pasang antena tv bintaro, pasang antena tv bogor, pasang antena tv bandung, pasang antena tv kelapa gading, pasang antena tv digital, ahli pasang antena tv, ahli pasang antena tv semarang, ahli pasang antena tv lokal, ahli pasang antena tv di banten, ahli pasang antena tv bekasi, ahli pasang antena tv bogor,agen ahli pasang antena tv,jasa ahli pasang parabola, parabola murah, parabola murah bandung, parabola murah, parabola murah bogor, pasang parabola Serpong, parabola murah tangerang
Keywords Cloud
accutuatoragenahliakanandaantenaantennaarahareaatasbandbarangbarubayuberbagaibergaransiberikutbesibisabuatcoaxialcontroldengandigitaldigital*untukdigital,dlldigital,servicedigital,settingdishdistribusigambargratishargaharihdmiintensitasiuranjasajatibeningjugakabelkamikasihkelengkapankepercayaankunjunganlnbflokalluarmatimatvmaupunmelaluimelayanimenggunakanmengurangimenjualmetermndapatkanmobilempegnovemberoffline,menerimaonlineorderotomatispadapaketpalapa/telkomparabolaparabola,bongkarparabola,pasangparabola,serviceparalelpasangpemasanganpemasangannyapercayakanperumahan,hotel,gedung,kantor,,dllpilihpipapositionerpratamareceiverremoterp..,/metersatelitsebagaisetiapsolid/jaringsplittertaiwantanpatiangtokotv,yangunituntukvenusyang
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! We've found 2 sitemaps files for your website:
https://pratamaantenatvdigital.blogspot.co.id/sitemap.xml
https://pratamaantenatvdigital.blogspot.com/sitemap.xml
SEO Friendly URL Test
  • We have found 4 URLs that are not SEO friendly!
See results list
Image Alt Test
  • Your webpage has 39 'img' tags and 33 of them are missing the required 'alt' attribute.
See full list
Inline CSS Test
  • Your webpage is using 11 inline CSS styles!
See results list
Deprecated HTML Tags
  • We found some HTML deprecated tags. You are advised to change these old tags with equivalent tags or proper CSS rules.
Google Analytics Test
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your web page.
Social Media Check
Speed optimizations
Score: 100
Failed: 1
Warnings: 0
Passed: 10
HTML Page Size Test
HTML Compression/GZIP Test
  • Congratulations! Your page is successfully compressed using gzip compression on your code.
    Your HTML is compressed from 161.01 Kb to 27.86 Kb (83 % size savings). This helps ensure a faster loading web page and improved user experience.
Site Loading Speed Test
  • Your site loading time is around 1.25 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 31
  • 1 HTML Pages
  • 5 CSS Files
  • 4 JS Files
  • 21 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
Image Caching Test
  • Congratulations! Your webpage use 'Expires' header for your images and the browsers will display these images from the cache.
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Checker
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 0
Failed: 1
Warnings: 0
Passed: 4
URL Canonicalization Test
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 30
Failed: 3
Warnings: 0
Passed: 4
Microdata Schema Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your webpage is using the canonical link tag. This tag specifies that the URL: http://pratamaantenatvdigital.blogspot.com should be the preferred version of this page. The canonical tag can be useful when there are similar versions of the same content on several URLs (e.g., such as e-commerce sites where URL modifiers like sort parameters are appended to a product page's URL). Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href='http://pratamaantenatvdigital.blogspot.com/' rel='canonical'/>
Nofollow Checker
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
Disallow Directive Checker
  • Your robots.txt file is using the disallow directive but it's empty. This means that the whole website can be crawled by search engines.
SPF Records Checker
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.

Check your website's SEO
Analyze and monitor your SEO with our powerful SEO ToolBox
Try the new features of our supercharged SEO ToolBox using a 7-day free trial account
seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
Company
Legal
© SEO Site Checkup 2020-2025 • All rights reserved