seo site checkup logo
PricingFree ToolsArticles
Report generated 2 years ago
https://phoenixdental.ca
Your general SEO Checkup Score
Archived
83/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 83 out of 100, which is higher than the average score of 75. Our analysis has identified 11 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
11 Failed
3 Warnings
57 Passed
Issues to fix
HIGH
Connect your webpage with social media networks using APIs or AddThis, as social signals are becoming increasingly important for search engines to validate a site's trustworthiness and authority.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
HTTP/2 protocol offers several key improvements, including faster page load times, improved performance, better security and more efficient use of network resources.
MEDIUM
Serving resources (images, JS, CSS) from a CDN service, could improve website loading times, reduce bandwidth costs and increase content availability and redundancy.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 80
Failed: 3
Warnings: 2
Passed: 20
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 72 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Dentist in Vancouver, BC | Dental Implants Near You | Invisalign Near Me
Length: 72 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Looking for a dentist in Vancouver, V5V 3C1? Phoenix Dental Implant and Invisalign Centre in British Columbia is the best dental implants near you. Contact us to book an appointment.
Length: 182 characters
Google Search Results Preview Test
Desktop version
https://phoenixdental.ca/Dentist in Vancouver, BC | Dental Implants Near You | Invisalign Near MeLooking for a dentist in Vancouver, V5V 3C1? Phoenix Dental Implant and Invisalign Centre in British Columbia is the best dental implants near you. Contact us to book an appointment.
Mobile version
https://phoenixdental.ca/Dentist in Vancouver, BC | Dental Implants Near You | Invisalign Near MeLooking for a dentist in Vancouver, V5V 3C1? Phoenix Dental Implant and Invisalign Centre in British Columbia is the best dental implants near you. Contact us to book an appointment.
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
en_US
og:site_name
Phoenix Dental Implant and Invisalign Centre
og:type
article
og:title
Dentist in Vancouver, BC | Dental Implants Near You | Invisalign Near Me
og:description
Looking for a dentist in Vancouver, V5V 3C1? Phoenix Dental Implant and Invisalign Centre in British Columbia is the best dental implants near you. Contact us to book an appointment.
og:url
https://phoenixdental.ca/
og:image
https://phoenixdental.ca/wp-content/uploads/2021/06/Dental-Crowns-2.jpg
og:image:secure_url
https://phoenixdental.ca/wp-content/uploads/2021/06/Dental-Crowns-2.jpg
og:image:width
1920
og:image:height
500
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
37dental16book13vancouver13invisalign11implant
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
dental
book
vancouver
invisalign
implant
Keywords Cloud Test
aminappointmentblogbookbracesbridgebridgescanalcarecentrecentredchildrencleaningclearclinicclosedcomplimentarycomprehensiveconsultationscontactcosmeticcosmeticscrownsdamageddegreedentaldentistdentistrydenturesdiscountdoctorsdowntowneastemergencyexamexperiencedextractionsfacialfaraghatfillingsfinancingfluorideformsfreegeneralgingivitishappyhomeimplantimplantsincludinginjectioninsuranceinvisalignkingswaylocationslookingmainmeetmenumissingnearneedsnelsonofficeopenoralpatientpatientsphoenixplatinumprovideproviderquicklyreshapingrestorerootsaturdaysaturdaysscansedationseniorservicesshirvanismilesouthteamteethtoothtraditionaltreatmentuniversityvancouverveneersvillanuevavisitweekendwelcomewhiteningzhang
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Vancouver Dentist Phoenix Dental Implant and Invisalign Centre
H2 tags
Free Implant & Cosmetic Consultations
Complimentary Invisalign Scan
We are a Platinum Invisalign Provider!
Welcome to Phoenix Dental Implant and Invisalign Centre
10% Senior Discount
Book an Appointment
Why Choose Us
Our Services
Meet Our Doctors
Reviews
Accepting Insurance
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
  • This website has a sitemap file.
SEO Friendly URL Test40% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test38% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test72% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test2% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test80% of top 100 sites passed
  • This webpage is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 83
Failed: 4
Warnings: 0
Passed: 19
HTML Page Size Test34% of top 100 sites passed
  • The size of this webpage's HTML is 19.82 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 2,563 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 104.66 Kb to 19.82 Kb (81% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 1.68 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
53.2 %
688.53 Kb
font
25.1 %
325.34 Kb
javascript
12.3 %
159.04 Kb
css
6.9 %
89.36 Kb
html
2.1 %
27.11 Kb
other
0.3 %
4.30 Kb
TOTAL
100%
1.26 Mb
Requests by content type
Content type
Percent
Requests
image
30.8 %
8
font
23.1 %
6
javascript
19.2 %
5
css
11.5 %
3
html
7.7 %
2
other
7.7 %
2
TOTAL
100%
26
Content size by domain
Domain
Percent
Size
phoenixdental.ca
83.4 %
1.05 Mb
static.adit.com
16.2 %
210.16 Kb
pozative.adit.com
0.3 %
4.30 Kb
TOTAL
100%
1.26 Mb
Requests by domain
Domain
Percent
Requests
phoenixdental.ca
57.7 %
15
static.adit.com
34.6 %
9
pozative.adit.com
7.7 %
2
TOTAL
100%
26
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • This webpage is not serving resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test
  • This webpage is not using images with large metadata.
Image Caching Test99% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test93% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test97% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is not using render-blocking resources.
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 1.26 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

1.26 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: WELCOME TO PHOENIX DENTAL IMPLANT AND INVISALIGN CENTRE BOOK NOW
Html: <div data-bg="https://phoenixdental.ca/wp-content/uploads/2021/0..." class="item itembanner1 rocket-lazyload entered lazyloade..." style="background-image: url("https://phoenixdental.ca/wp..." data-ll-status="loaded">
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.004. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.

0.0042

0.1

0.25

DOM element which contributes the most to CLS score:
Text: 770 Kingsway, Vancouver, BC V5V 3C1 604-708-3433 BOOK APPOINTMENT HOME ABOUT P...
Html: <div class="header-right">
Score: 0.0024
Server and security
Score: 76
Failed: 3
Warnings: 0
Passed: 7
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "phoenixdental.ca" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
phoenixdental.ca
Subject Alternative Names (SANs)
phoenixdental.ca, www.phoenixdental.ca
Not valid before
Thu, February 9o 2023, 12:00:00 am (z)
Not valid after
Wed, May 10o 2023, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
cPanel, Inc. Certification Authority
Intermediate certificate
Common name
cPanel, Inc. Certification Authority
Organization
cPanel, Inc.
Location
Houston, TX, US
Not valid before
Mon, May 18o 2015, 12:00:00 am (z)
Not valid after
Sat, May 17o 2025, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
COMODO RSA Certification Authority
Root certificate
Common name
COMODO RSA Certification Authority
Organization
COMODO CA Limited
Location
Salford, Greater Manchester, GB
Not valid before
Tue, January 19o 2010, 12:00:00 am (z)
Not valid after
Mon, January 18o 2038, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
COMODO RSA Certification Authority
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is not using the HTTP/2 protocol!
HSTS Test
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test93% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1, shrink-to-fit=no" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 98
Failed: 1
Warnings: 1
Passed: 8
Structured Data Test59% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://phoenixdental.ca/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://phoenixdental.ca/" rel="canonical"/>
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:secureserver.net -all
Ads.txt Validation Test80% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved