seo site checkup logo
PricingFree ToolsArticles
Report generated 7 years ago
http://www.oneworldunited.in
Your general SEO Checkup Score
Archived
72/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 72 out of 100, which is below the average score of 75. However, there are 19 SEO issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
19 Failed
3 Warnings
25 Passed
Common SEO issues
Score: 54
Failed: 5
Warnings: 2
Passed: 10
Meta Title
  • Congratulations! Your webpage is using a title tag
Text: One World United – Event Management & Design Company
Meta Description
  • The meta description tag is missing from your page. You should include this tag in order to provide a brief description of your page which can be used by search engines. Well-written and inviting meta descriptions may also help click-through rates to your site in search engine results.
Google Search Results Preview
Desktop version
http://www.oneworldunited.inOne World United – Event Management & Design Company
Mobile version
http://www.oneworldunited.inOne World United – Event Management & Design Company
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
9event9wedding9best8destination5contact
Keywords Usage Test
  • Your most common keywords are not appearing in one or more of the meta-tags above. Your primary keywords should appear in your meta-tags to help identify the topic of your webpage to search engines.
Keyword(s) included in Title tag
Keyword(s) not included in Meta-Description tag
Keywords Cloud
artistsawaybeatsbestbettercarechoudharyclientcloseconcertsconnectedconsideredcontactcontentcorporatecosmosdesigndesigningdestinationdidn’tdirectordreamingeveningeventeventsexactlyexecutionexoticexperiencefacebookfamilyfollowfoodfreegallerygatheringharshulhugeiiiminternationalit'sjaipurjustknowkotharileavelifetimelinkedinlivelylookingloveluxurymakemakingmansarovarmeccameetingsmelodiesmemoriesmusicmusicalnearneedneedsnightoff-shorepartyperfectphotographersplacesplanplannersportfoliopre-weddingproblemsproductrealityrequiredsearchserviceservicesshootsiteskipsolvingsureswatiteamtimetwittertypingudaipurunitedviewweddingweddingswideworkworldworries
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your page contains too many H2 tags. H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
International Luxury Wedding & Event Planners
What They Say
We’re Committed to Service Excellence
Request a call back!
H2 tags
Corporate Events
Weddings
Concerts
Gallery
Destination Sourcing
About EDD Events
Pre-Wedding
Rendezvous
Exhibitions
Entertainment
Product Launches
Contact Us
Harshul Kothari
Swati Choudhary
Robots.txt Test
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test
  • Your site lacks a sitemap file. Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
Image Alt Test
  • Your webpage contains "img" tags without the required "alt" atribute.
See full list
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your webpage.
Speed optimizations
Score: 2
Failed: 7
Warnings: 1
Passed: 0
HTML Page Size Test
HTML Compression/GZIP Test
  • Your webpage doesn't use any HTML compression! You should compress your HTML to reduce your page size and page loading times - this will help your site retain visitors and increase page views. If you were using compression, you could be compressing your HTML size by 79% - from 76.0 Kb to 15.93 Kb .
Site Loading Speed Test
  • Your website loading time is around 17.42 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 71
  • 1 HTML Pages
  • 17 CSS Files
  • 18 JS Files
  • 35 Images
  • 0 Flash Files
Image Caching Test
  • Your site is not using cache headers for your images. The cache headers can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
JavaScript Minification Test
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test
  • Some of your website's CSS files are not minified!
See results list
URL Redirects Checker
  • Your URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Server and security
Score: 53
Failed: 2
Warnings: 0
Passed: 1
URL Canonicalization Test
HTTPS Test
Plaintext Emails Test
  • We've found 1 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 30
Failed: 3
Warnings: 0
Passed: 3
Microdata Schema Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your webpage is using the canonical link tag. This tag specifies that the URL: http://www.oneworldunited.in/ should be the preferred version of this page. The canonical tag can be useful when there are similar versions of the same content on several URLs (e.g., such as e-commerce sites where URL modifiers like sort parameters are appended to a product page's URL). Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="http://www.oneworldunited.in/" rel="canonical"/>
Nofollow Checker
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Checker
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
See results list
SPF records checker
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2026 • All rights reserved