seo site checkup logo
PricingFree ToolsArticles
Report generated 4 years ago
https://ohbaby.gr
Your general SEO Checkup Score
Archived
87/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 87 out of 100, which is higher than the average score of 75. Our analysis has identified 8 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
8 Failed
2 Warnings
42 Passed
Common SEO issues
Score: 77
Failed: 3
Warnings: 2
Passed: 15
Meta Title Test
  • Congratulations! Your webpage is using a title tag
Text: OhBaby - Online Κατάστημα βρεφικών — Oh Baby!
Meta Description Test
  • Congratulations! Your webpage is using a meta description tag
Text: Είμαστε η Κατερίνα,ο Δημήτρης , ο Θάνος και η Ναταλία και σε καλωσορίζουμε στο Oh Baby, ένα μικρό concept store με ότι έψαχνες μέχρι τώρα, αλλά δεν έβρισκες!
Google Search Results Preview Test
Desktop version
https://ohbaby.grOhBaby - Online Κατάστημα βρεφικών — Oh Baby!Είμαστε η Κατερίνα,ο Δημήτρης , ο Θάνος και η Ναταλία και σε καλωσορίζουμε στο Oh Baby, ένα μικρό concept store με ότι έψαχνες μέχρι τώρα, αλλά δεν έβρισκες!
Mobile version
https://ohbaby.grOhBaby - Online Κατάστημα βρεφικών — Oh Baby!Είμαστε η Κατερίνα,ο Δημήτρης , ο Θάνος και η Ναταλία και σε καλωσορίζουμε στο Oh Baby, ένα μικρό concept store με ότι έψαχνες μέχρι τώρα, αλλά δεν έβρισκες!
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
32toys28αξεσουάρ21καλάθι18άμεση18παραλαβή
Keywords Usage Test
  • Your most common keywords are not appearing in one or more of the meta-tags above. Your primary keywords should appear in your meta-tags to help identify the topic of your webpage to search engines.
Keyword(s) not included in Title tag
Keyword(s) not included in Meta-Description tag
Keywords Cloud Test
accessoriesbabybagsbenutabexabritaxchillysclassiccoffeecookiesecozoifatbraingiftgroupkidskidwelllakenlinelittlemeycomonkeyohbabypartyperegoplayromershopsizetoysweekenderάμεσηαλλαξιέραςαλλαξιέρεςαντισηπτικάαξεσουάραποστολήασφάλειεςβρεφικάγρήγορηγυαλιάδιακόσμησηδιδύμωνδωράκιαδώραεκπαιδευτικάετώνημέρεςθήκεςθερμόςθηλασμούισορροπίαςκαλάθικαλάθιακαλύμματακαροτσιούκαρότσιακρεβάτιλίκνομάσκεςμαγιώμαξιλάριαμεταφοράμουσελίνεςμπάνιουμωρούμόμπιλενερούξύλιναξύλινοοθόνηςομπρέλεςπαιδικάπαιδικέςπαιχνίδιαπανάκιαπαραλαβήπαρηγοριάςπατίνιαπεριπάτουπετσέτεςποδήλαταποδιέςποδόσακοιπολυκαρότσιαπροβολήπροσθήκηπροστατευτικάσκηνέςστρωματάκιαστρώματασυσκευέςσχολικάτσάντεςυπνόσακοιφαγητοδοχείαφαγητούφορητάχαλάκιαχαλιάύπνου
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your page contains too many H2 tags. H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Γνώρισε την Kidwell
Gift Guide
Britax Romer Corner
New Arrivals
Back In Stock
H2 tags
Real Shades
Πατίνια Kidwell
Balance Bikes Kidwell
Καρότσια Kidwell
Καρεκλάκια Φαγητού Kidwell
Relax Kidwell
Γυμναστήρια Kidwell
Λίκνα Kidwell
KidWell- Approved by children
Toystore
Δωράκια ως 15€
Δωράκια από 15€-30€
Δωράκια από 30€-50€
Δωράκια 50€+
Ποδήλατα Ισορροπίας/ Πατίνια
Μαμά/Μπαμπάς/Νονά/Νονός
Oh!Baby Gift Card
0-18kg Group 0-1
9-36kg Group 1-2-3
15-36kg Group 2-3
Britax Romer
Chillys Series 2 Coffee Cup 340ml Maple Red
Chillys Series 2 Coffee Cup 340ml Pine Green
New Classic Toys Ξύλινο Μαύρο Ηλεκτρικό Πιάνο - 25 Νότες
New Classic Toys Ξύλινη Κιθάρα Yellow
New Classic Toys Ζώνη με Ξύλινα Εργαλεία Πορτοκαλί
New Classic Toys Ξύλινο Ρολόι με Σχήματα
New Classic Toys Ξύλινο Παιχνίδι Στοίβαξης Rainbow - 10 Κομμάτια
New Classic Toys - Shape Sorting Cube
New Classic Toys Ξύλινο Shape Block Puzzle - 9 Ζωάκια
New Arrivals
Ecozoi Lunch Box Σετ 4τμχ
Chillys Coffee Cup 500ml Rose Gold
Chillys Coffee Cup 500ml Blush Pink
Chillys Coffee Cup 340ml Black
Chillys Coffee Cup 340ml Matte Green
Meyco Υπνόσακος 2,2 Tog Χειμερινός 0-6 Μηνών (70-90 cm) Diamond Avocado
Meyco Υπνόσακος 2,2 Tog Χειμερινός 6-18 Μηνών (90-110 cm) Diamond Honey
Meyco Υπνόσακος 2,2 Tog Χειμερινός 18+ Μηνών (110 cm) Panther Neutral
Bemini Magic Bag Υπνόσακος 3 Tog Χειμωνιάτικος 3-9 Μηνών (55-80cm) Pady Jersey Flamingo
Back In Stock
Επικοινωνία
Κατάστημα
Βρες μας κι εδώ
Γίνε μέλος του OhBaby Exclusive Club
Χρήσιμα
Πρόσθεσες στο καλάθι σου:
Οι προτιμήσεις σου για την προστασία δεδομένων προσωπικού χαρακτήρα
Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! Your website has a sitemap file.
SEO Friendly URL Test
  • Congratulations! All links from your webpage are SEO friendly.
Image Alt Test
  • Your webpage is using "img" tags with empty or missing "alt" attribute.
See full list
Inline CSS Test
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • We've found JavaScript errors on your webpage!
See results list
Social Media Test
  • Congratulations! Your website is connected successfully with social media using:
Facebook Google Plus 
Speed optimizations
Score: 91
Failed: 2
Warnings: 0
Passed: 14
HTML Page Size Test
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using br compression on your code. Your HTML is compressed from 1035.95 Kb to 138.39 Kb (87% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 2.83 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Total Objects: 111
  • 8 HTML Pages
  • 9 CSS Files
  • 39 JS Files
  • 55 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test
  • Your webpage is serving all images, javascript and css resources from CDNs.
See results list
Image Caching Test
  • Your webpage is not using uncached images from your domain.
JavaScript Caching Test
  • Your webpage is not using uncached JavaScript resources from your domain.
CSS Caching Test
  • Your webpage is not using uncached CSS resources from your domain.
JavaScript Minification Test
  • Congratulations! Your website's JavaScript files are minified!
See results list
CSS Minification Test
  • Congratulations! Your webpage's CSS resources are minified.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 91
Failed: 1
Warnings: 0
Passed: 5
URL Canonicalization Test
HTTPS Test
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • We've found 7 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 89
Failed: 2
Warnings: 0
Passed: 6
Structured Data Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Custom 404 Error Page Test
  • Congratulations, your website is using a custom 404 error page. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://ohbaby.gr is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://ohbaby.gr/" rel="canonical"/>
Nofollow Tag Test
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
See results list
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF Records Test
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved