seo site checkup logo
PricingFree ToolsArticles
Report generated 4 years ago
https://netcom.co.in
Your general SEO Checkup Score
Archived
82/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 82 out of 100, which is higher than the average score of 75. Our analysis has identified 19 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
19 Failed
3 Warnings
44 Passed
Common SEO issues
Score: 85
Failed: 3
Warnings: 0
Passed: 19
Meta Title Test100% of top 100 sites passed
  • Congratulations! Your webpage is using a title tag
Text: Best Computer Hard Disk Data recovery service in Nagpur (2022)
Meta Description Test97% of top 100 sites passed
  • Congratulations! Your webpage is using a meta description tag
Text: Netcom System A trusted data recovery solution
Google Search Results Preview Test
Desktop version
https://netcom.co.inBest Computer Hard Disk Data recovery service in Nagpur (2022)Netcom System A trusted data recovery solution
Mobile version
https://netcom.co.inBest Computer Hard Disk Data recovery service in Nagpur (2022)Netcom System A trusted data recovery solution
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:title
Data Recovery Service In Nagpur (Netcom System)
og:description
Your Trusted Data Recovery Partner
og:image
https://netcom.co.in/og-image.png
og:url
https://netcom.co.in/
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
106recovery36recover31have28drive27raid
Keywords Usage Test81% of top 100 sites passed
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
accessoriesandroidantivirusbestbitraserblackberrybusinesscameracardcctvclientscliniccomputercontactcorruptcustomersdamageddatabasedeleteddesktopdevicedisasterdiskdrivedrivesemailencryptedenterpriseeraserescanfailedfaultyfilefilesflashfreehappyhardhavehelpimagesindiainfoipadiphoneitadsjpegknowlaptoplikelostmaintenancemediamemorymobilenagpurnetcomnotebookoptionspartitionpartnerperipheralsphonephotopostmasterproductsprofessionalsqualityraidrecoverrecoveryremovablerepairsalessanitizationserverserversserviceservicessoftwaresoftwaressolutionsolutionsspecializationspecializedssdsstellarstoragesymbiantallytechtimetoolstypesvariousvideovideosviruswindowswipe
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • Congratulations! Your webpage contains headings tags.
H1 tags
Netcom System : Data Recovery Solution In Nagpur
H2 tags
Unlimited Data Recovery Options
Netcom System is an authorised partner of Stellar
Netcom's Notebook Clinic
About Netcom System
Data Loss.! Don't worry Netcom System is here
Try Stellar's Softwares Free and Professional editions
and so much more...
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
  • Congratulations! Your website has a sitemap file.
Image Alt Test71% of top 100 sites passed
  • Your webpage is using "img" tags with empty or missing "alt" attribute.
See full list
Responsive Image Test38% of top 100 sites passed
  • Not all images in this page are properly sized! You are serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Deprecated HTML Tags Test99% of top 100 sites passed
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • Congratulations! There are no severe JavaScript errors on your webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
meta charset="utf-8"
Speed optimizations
Score: 40
Failed: 9
Warnings: 1
Passed: 5
HTML Page Size Test34% of top 100 sites passed
  • Congratulations! The size of your webpage's HTML is 12.11 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 4,725 nodes which is greater than the recommended value of 1,500 nodes. A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 101.95 Kb to 12.11 Kb (88% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • Your website loading time is around 6.7 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Content size by content type
Content type
Percent
Size
image
90.8 %
5.17 Mb
javascript
4.6 %
269.69 Kb
font
2.4 %
138.45 Kb
css
2.0 %
117.79 Kb
html
0.2 %
10.64 Kb
other
0.0 %
303 B
TOTAL
100%
5.69 Mb
Requests by content type
Content type
Percent
Requests
image
67.5 %
102
javascript
15.9 %
24
css
11.9 %
18
font
2.6 %
4
html
1.3 %
2
other
0.7 %
1
TOTAL
100%
151
Content size by domain
Domain
Percent
Size
netcom.co.in
97.7 %
5.56 Mb
googletagmanager.com
1.2 %
69.48 Kb
fonts.gstatic.com
1.0 %
60.41 Kb
fonts.googleapis.com
0.0 %
1.34 Kb
google-analytics.com
0.0 %
303 B
TOTAL
100%
5.69 Mb
Requests by domain
Domain
Percent
Requests
netcom.co.in
96.7 %
146
fonts.gstatic.com
1.3 %
2
fonts.googleapis.com
0.7 %
1
googletagmanager.com
0.7 %
1
google-analytics.com
0.7 %
1
TOTAL
100%
151
CDN Usage Test96% of top 100 sites passed
  • Your webpage is not serving all resources (images, javascript and css) from CDNs.
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format. Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Caching Test99% of top 100 sites passed
  • Your website is not using cache headers for your images. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
JavaScript Caching Test98% of top 100 sites passed
  • Your website is not using cache headers for your JavaScript resources. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site.
CSS Caching Test98% of top 100 sites passed
  • Your website is not using cache headers for your CSS resources. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site.
See results list
JavaScript Minification Test93% of top 100 sites passed
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test97% of top 100 sites passed
  • Congratulations! Your webpage's CSS resources are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help your page load significantly faster and improve the website experience for your visitors.
See results list
URL Redirects Test96% of top 100 sites passed
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 28
Failed: 4
Warnings: 1
Passed: 1
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • Your website is successfully using the HTTPS protocol, but the SSL Certificate will expire in less than a month! Having an up-to-date certificate is an important security practice to ensure that your website is safe and provides trust, and any communication between the user's browser and your website (such as passwords, credit cards, or forms) is encrypted and private.

The certificate is not used before the activation date.

The certificate will expire in less than a month!

The hostname "netcom.co.in" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
netcom.co.in
Subject Alternative Names (SANs)
netcom.co.in, cpanel.netcom.co.in, cpcalendars.netcom.co.in, cpcontacts.netcom.co.in, mail.netcom.co.in, netcom.prasima.com, webdisk.netcom.co.in, webmail.netcom.co.in, whm.netcom.co.in, www.netcom.co.in, www.netcom.prasima.com
Not valid before
Fri, April 1o 2022, 12:00:00 am (z)
Not valid after
Thu, June 30o 2022, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
cPanel, Inc. Certification Authority
Intermediate certificate
Common name
cPanel, Inc. Certification Authority
Organization
cPanel, Inc.
Location
Houston, TX, US
Not valid before
Mon, May 18o 2015, 12:00:00 am (z)
Not valid after
Sat, May 17o 2025, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
COMODO RSA Certification Authority
Root certificate
Common name
COMODO RSA Certification Authority
Organization
COMODO CA Limited
Location
Salford, Greater Manchester, GB
Not valid before
Tue, January 19o 2010, 12:00:00 am (z)
Not valid after
Mon, January 18o 2038, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
COMODO RSA Certification Authority
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • Congratulations, this webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is not using the HTTP/2 protocol!
Plaintext Emails Test93% of top 100 sites passed
  • We've found 1 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, minimum-scale=1.0, maximum-scale=1.0, user-scalable=no" />
Media Query Responsive Test99% of top 100 sites passed
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 52
Failed: 2
Warnings: 1
Passed: 6
Structured Data Test59% of top 100 sites passed
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Custom 404 Error Page Test75% of top 100 sites passed
  • Your website is not using a custom 404 error page. Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave your site entirely, and looks unprofessional. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test99% of top 100 sites passed
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • Your webpage does not use the canonical link tag.
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
Meta Refresh Test95% of top 100 sites passed
  • Congratulations, this webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 +a +mx +ip4:3.6.208.121 ~all
Ads.txt Validation Test80% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2026 • All rights reserved