seo site checkup logo
PricingFree ToolsArticles
Report generated 8 years ago
http://mundilembos.blogspot.co.id
Your general SEO Checkup Score
Archived
77/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 77 out of 100, which is higher than the average score of 75. Our analysis has identified 7 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
7 Failed
1 Warnings
33 Passed
Common SEO issues
Score: 59
Failed: 4
Warnings: 1
Passed: 11
Google Search Results Preview
Desktop version
http://mundilembos.blogspot.co.id/Mundi Lembos - Software Tutorial & All About ComputerMundi Lembos Blog adalah media yang memuat berbagai software, tutorial dan apa saja seputar dunia komputer.
Mobile version
http://mundilembos.blogspot.co.id/Mundi Lembos - Software Tutorial & All About ComputerMundi Lembos Blog adalah media yang memuat berbagai software, tutorial dan apa saja seputar dunia komputer.
Keywords Cloud
adalahadminagarakanamirandaantivirusaplikasiartikelautomaticbagibermainbiasabisacaracodecommentcukupdalamdapatdaridecoderdemikiandengandigunakandownloadfiturfreehackerhanyainterfacejadijelasjikajugajumpakamikarenakecepatankeyboardkodelainnyalangsunglebihlengkaplinkmaximizemembuatmempunyaimenarikmenggunakanmenjadimerupakanmorsemungkinnamanyanamunonlinepadapengembanganpenggunaperbaikanpianoplayingprocessprofitprosessaatsajasampaisangatsaransayonarasedangsehinggaselaluselanjutnyasepertisinisistemskipsmadavsoftwaresoundsuarasudahsupporttelahtentangterbaruterimakasihtexttidaktungguunikuntukversiversionyaituyang
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! We've found 2 sitemaps files for your website:
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test
  • We have found 16 URLs that are not SEO friendly!
See results list
Image Alt Test
  • Your webpage has 34 'img' tags and 14 of them are missing the required 'alt' attribute.
See full list
Inline CSS Test
  • Your webpage is using 21 inline CSS styles!
See results list
Deprecated HTML Tags
  • We found some HTML deprecated tags. You are advised to change these old tags with equivalent tags or proper CSS rules.
Google Analytics Test
  • Congratulations! Your website is using the latest version of Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • We found one JavaScript error on your web page!
See results list
Social Media Check
Speed optimizations
Score: 100
Failed: 1
Warnings: 0
Passed: 10
HTML Page Size Test
HTML Compression/GZIP Test
  • Congratulations! Your page is successfully compressed using gzip compression on your code.
    Your HTML is compressed from 113.34 Kb to 26.00 Kb (77 % size savings). This helps ensure a faster loading web page and improved user experience.
Site Loading Speed Test
  • Your site loading time is around 3.281 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 86
  • 10 HTML Pages
  • 10 CSS Files
  • 20 JS Files
  • 46 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
Image Caching Test
  • Congratulations! Your webpage use 'Expires' header for your images and the browsers will display these images from the cache.
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Checker
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 0
Failed: 0
Warnings: 0
Passed: 5
URL Canonicalization Test
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 50
Failed: 2
Warnings: 0
Passed: 5
Microdata Schema Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • We've found 2 canonical link tags. When more than one is specified, all canonical tags will be ignored!
<link href='http://mundilembos.blogspot.com/' rel='canonical'/>
<link href='http://mundilembos.blogspot.co.id/' rel='canonical'/>
Nofollow Checker
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Checker
  • Your robots.txt file is using the disallow directive but it's empty. This means that the whole website can be crawled by search engines.
SPF Records Checker
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved