seo site checkup logo
PricingFree ToolsArticles
Report generated 2 years ago
https://metmuller.nl
Your general SEO Checkup Score
Archived
100/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 105 out of 100, which is higher than the average score of 75. Our analysis has identified 9 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
9 Failed
1 Warnings
62 Passed
Issues to fix
HIGH
H1 and H2 tags ensure better search engine visibility and ranking by providing structure and hierarchy to the content, improving readability, and providing opportunities for keyword optimization.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Add descriptive and relevant "alt" attributes to all "img" tags to improve website accessibility.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
LOW
To protect against spam harvesters, consider hiding or obfuscating email addresses in your page code.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 73
Failed: 4
Warnings: 0
Passed: 18
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Internetbureau MetMuller | Websites & Online Marketing ★
Length: 56 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Je website laten maken door Metmuller betekent: ✅ Persoonlijk support ✅ Binnen twee weken online ✅ Makkelijk zelf te beheren ✅ Goed vindbaar in Google
Length: 150 characters
Google Search Results Preview Test
Desktop version
https://metmuller.nl/Internetbureau MetMuller | Websites & Online Marketing ★Je website laten maken door Metmuller betekent: ✅ Persoonlijk support ✅ Binnen twee weken online ✅ Makkelijk zelf te beheren ✅ Goed vindbaar in Google
Mobile version
https://metmuller.nl/Internetbureau MetMuller | Websites & Online Marketing ★Je website laten maken door Metmuller betekent: ✅ Persoonlijk support ✅ Binnen twee weken online ✅ Makkelijk zelf te beheren ✅ Goed vindbaar in Google
Social Media Meta Tags Test94% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
nl_NL
og:type
article
og:title
Homepagina
og:description
Internetbureau MetMuller Metmuller heeft zich gespecialiseerd in het ontwerpen, bouwen, hosten en onderhouden van op maat gemaakte WordPress websites, evenals in het ontwikkelen van effectieve online marketingstrategieën en e-commerce optimalisatie. vraag een offerte aan Metmuller heeft zich
og:url
https://metmuller.nl/
og:site_name
MetMuller
og:updated_time
2023-06-16T12:09:36+02:00
og:image
https://metmuller.nl/wp-content/uploads/Logo_metmuller-1.svg
og:image:secure_url
https://metmuller.nl/wp-content/uploads/metmuller-logo-def.-400px.png
og:image:width
400
og:image:height
400
og:image:alt
MetMuller
og:image:type
image/png
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
22website19marketing16metmuller12onze12contact
Keywords Usage Test44% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
website
marketing
metmuller
onze
contact
Keywords Cloud Test
abonnementsconstructiesaccountmanagersallealleenbedrijvenbehalenbekijkbingoblogbouwenbovenaanbrabantsebullshcampagnescasecommercecontactcontentdankzijdienstendoeneffectieveevenalsgaangeengemaaktegespecialiseerdgevondengewoongooglegratishebtheefthelpenhomehomepaginahostenhostinghuisstijlhuisstijlontwerpinternetbureauklarekrijgtlatenleggenmaatmailmarketingmakenmarketingmarketingstrategieënmediameermeestmentaliteitmetmullernaarnavigationneemnietnieuwenieuwsbriefnodignoemennuchtereofferteonderhoudonderhoudenonlineontwerpontwerpenontwikkelenonzeoptimalisatieottopakketpersoonlijkrendementresultaatsocialsturensupporttaaltoggleveghelveneficusvoorvraagvreemdewaaromwebshopwebsitewebsitecheckwebsiteswerkwerkwijzewordpresswordtzichzijnzorgen
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test57% of top 100 sites passed
  • This webpage does not contain H1 headings! H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
Onze marketing diensten
Persoonlijk contact
Wij sturen op resultaat
Nuchtere Brabantse mentaliteit
Ons werk
150% groei in organisch website verkeer
Een greep uit onze klanten
Samen metmuller een project opstarten?
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test80% of top 100 sites passed
Image Alt Test76% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test31% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test68% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Deprecated HTML Tags Test92% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test73% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test58% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test32% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test98% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Speed optimizations
Score: 88
Failed: 2
Warnings: 0
Passed: 18
HTML Page Size Test17% of top 100 sites passed
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,249 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 1240.81 Kb to 171.37 Kb (86% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 1.69 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test78% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage has less than 20 http requests. A higher number of http requests results in a user's browser needing to request a large number of objects from the server, which will ultimately slow down the loading of your webpage.
Content size by content type
Content type
Percent
Size
font
35.5 %
192.02 Kb
html
32.5 %
176.04 Kb
image
26.3 %
142.38 Kb
css
4.2 %
22.74 Kb
javascript
1.5 %
8.24 Kb
other
0.0 %
0 B
TOTAL
100%
541.42 Kb
Requests by content type
Content type
Percent
Requests
font
41.2 %
7
image
29.4 %
5
javascript
17.6 %
3
html
5.9 %
1
css
5.9 %
1
other
0.0 %
0
TOTAL
100%
17
Content size by domain
Domain
Percent
Size
metmuller.nl
85.0 %
460.34 Kb
fonts.gstatic.com
15.0 %
81.08 Kb
TOTAL
100%
541.42 Kb
Requests by domain
Domain
Percent
Requests
metmuller.nl
76.5 %
13
fonts.gstatic.com
23.5 %
4
TOTAL
100%
17
CDN Usage Test96% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test26% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test69% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test98% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test99% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test14% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.753 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.753 s

0.8 s

1.8 s

First Contentful Paint Test97% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 0.958 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

0.958 s

1.8 s

3 s

Largest Contentful Paint Test92% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 1.13 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

1.13 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img decoding="async" fetchpriority="high" width="1200" height="800" alt="MetMuller internetbureau" title="Internetbureau MetMuller" src="data:image/svg+xml,%3Csvg%20xmlns='http://www.w3.o..." class="img-responsive wp-image-24328" data-lazy-srcset="https://metmuller.nl/wp-content/uploads//Header-af..." data-lazy-sizes="(max-width: 1024px) 100vw, (max-width: 640px) 100v..." data-lazy-src="https://metmuller.nl/wp-content/uploads/Header-afb...">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.0000. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0

0.1

0.25

DOM element which contributes the most to CLS score:
Text: MKB website laten maken
Html: <a href="https://metmuller.nl/diensten/mkb-website-laten-ma..." class="awb-menu__main-a awb-menu__main-a_regular">
Score: 0.0000
Server and security
Score: 91
Failed: 2
Warnings: 0
Passed: 5
URL Canonicalization Test96% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "metmuller.nl" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
metmuller.nl
Subject Alternative Names (SANs)
metmuller.nl, *.metmuller.nl
Not valid before
Wed, September 20o 2023, 11:52:50 am (z)
Not valid after
Tue, December 19o 2023, 11:52:49 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GTS CA 1P5
Intermediate certificate
Common name
GTS CA 1P5
Organization
Google Trust Services LLC
Location
US
Not valid before
Thu, August 13o 2020, 12:00:42 am (z)
Not valid after
Thu, September 30o 2027, 12:00:42 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GTS Root R1
Root certificate
Common name
GTS Root R1
Organization
Google Trust Services LLC
Location
US
Not valid before
Wed, June 22o 2016, 12:00:00 am (z)
Not valid after
Sun, June 22o 2036, 12:00:00 am (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
GTS Root R1
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test95% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test85% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Plaintext Emails Test99% of top 100 sites passed
  • We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test90% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test100% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 98
Failed: 0
Warnings: 1
Passed: 8
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test78% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test100% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test96% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://metmuller.nl/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://metmuller.nl/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • The robots.txt file does not use the disallow directive. This means that the whole website can be crawled by search engines.
See results list
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test97% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:_spf.google.com ~all
Ads.txt Validation Test66% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2026 • All rights reserved