seo site checkup logo
PricingFree ToolsArticles
Report generated 10 years ago
http://lovepolo.it
Your general SEO Checkup Score
Archived
97/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 97 out of 100, which is higher than the average score of 75. Our analysis has identified 11 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
11 Failed
0 Warnings
27 Passed
Common SEO issues
Score: 77
Failed: 2
Warnings: 0
Passed: 10
Google Search Results Preview Test
Desktop version
http://lovepolo.it/?v=7516fd43adaaLove Polo – Beautiful Design brand
Mobile version
http://lovepolo.it/?v=7516fd43adaaLove Polo – Beautiful Design brand
Keywords Cloud Test
accountantiqueapplicationargentinaautographbigodinocarecartcheckoutchoosecodecollectioncollectionscommentcommercialcontactcontentcopyrightcopyright©cufflinksdeliverydetailsemailfavoritefittedforgotfreegreyheartheartshoodiesinfo@lovepolo.itinternationaljuankidslinkloginlostlovelovepolo.itlovepolosasmainmartinmobilemongoliamoralesmunozneroonorderorderspartypasswordplayerpolicypolopolotvpopularpresspreviewprintedprivacyproductquickrecentreservedreturnsrightsrocioromeshippingshirtshirtsshopshoppingsignstandardsuitssummersweatsweatshirtsweatshirtsswimmingt_shirttanktattotenceltopstshirtsuniqueusernamevarietyvioletvisonewearwearswebsitewishlistwomen remember×close
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Your site lacks a sitemap file. Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
Image Alt Test
  • Your webpage has 21 'img' tags and all of them has the required 'alt' attribute.
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Your website does not include Google Analytics tracker script or this script is not properly installed. You are advised to use Google Analytics (and properly install the tracker script) in order to get detailed statistics about your website's traffic and traffic sources.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulation! There is no occurrence of any severe JavaScript Errors in your web page.
Speed optimizations
Score: 0
Failed: 5
Warnings: 0
Passed: 0
HTML Page Size Test
HTML Compression/GZIP Test
  • Your page do not use any HTML compression!
    You should compress your HTML to reduce your page size and page loading times - this will help your site retain visitors and increase page views. If you were using compression, you could be compressing your HTML size by 79 % - from 57.54 Kb to 12.25 Kb which would further reduce your page loading time.
Site Loading Speed Test
  • Your site loading time is around 24.025 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
Total Objects: 70
  • 2 HTML Pages
  • 17 CSS Files
  • 33 JS Files
  • 18 Images
  • 0 Flash Files
Image Caching Test
  • Your site is not using expires headers for your images. An expires tag can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
Server and security
Score: 0
Failed: 1
Warnings: 0
Passed: 1
URL Canonicalization Test
HTTPS Test
Plaintext Emails Test
  • We found 1 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 63
Failed: 1
Warnings: 0
Passed: 4
Structured Data Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage is using the canonical link tag. This means that your webpage is not the preferred one to use in the search results.
<link rel="canonical" href="http://lovepolo.it/" />
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engins will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved