seo site checkup logo
PricingFree ToolsArticles
Report generated 8 years ago
http://littlejohnflooring.co.uk
Your general SEO Checkup Score
Archived
100/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 118 out of 100, which is higher than the average score of 75. Our analysis has identified 6 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
6 Failed
0 Warnings
34 Passed
Common SEO issues
Score: 100
Failed: 0
Warnings: 0
Passed: 12
Google Search Results Preview
Desktop version
http://littlejohnflooring.co.uk/Littlejohn Flooring, Ashford KentAshford based family run flooring business with years of experience offering mobile showroom with variety of samples, bringing them directly to your home or business at a time convenient for you. Based in Ashford serving all of the county of Kent
Mobile version
http://littlejohnflooring.co.uk/Littlejohn Flooring, Ashford KentAshford based family run flooring business with years of experience offering mobile showroom with variety of samples, bringing them directly to your home or business at a time convenient for you. Based in Ashford serving all of the county of Kent
Keywords Cloud
ancillariesashfordbarsbasedbeadingbringingbusinesscarecarpetcarpetscarriedcloudcomputingcondorcontactconvenientcormarcuttingdependabledirectlydon'tdoorexperienceextrasfamilyfeatherfeelfinishingfittedfittingfloorflooringfreegivinggrippergrippershardwearinghomeimpressivejointsjustkentlaminatelaminateslayinglittlejohnmakemetremobilemodernofferpersonalplaceplyboardpopularprimingpriorprivacyprovidequalityquicksteprangereducerequiredrevolutionsamplesscreedsealantselflevellingsemaphoresendserviceshowroomsiliconesmoothspecialspraystylesstylishsubcontractorssuitsuitabletapetimetwistunderlayunisounduplift/disposalvarietyvinylswalkingwarmwarrantywebsitewidewoodwoolworkyearyears
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! We've found 1 sitemap file for your website:
Image Alt Test
  • Your webpage has 11 'img' tags and all of them contain the required 'alt' attribute.
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your website is using the latest version of Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your web page.
Speed optimizations
Score: 55
Failed: 2
Warnings: 0
Passed: 4
HTML Page Size Test
HTML Compression/GZIP Test
  • Your page do not use any HTML compression!
    You should compress your HTML to reduce your page size and page loading times - this will help your site retain visitors and increase page views. If you were using compression, you could be compressing your HTML size by 75 % - from 19.21 Kb to 4.85 Kb which would further reduce your page loading time.
Site Loading Speed Test
  • Your site loading time is around 3.916 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
  • Congratulations, your page has fewer than 20 http requests. A higher number of http requests results in a user's browser needing to request a large number of objects from your server, which will ultimately slow down the loading of your web page.
Total Objects: 20
  • 1 HTML Pages
  • 2 CSS Files
  • 3 JS Files
  • 14 Images
  • 0 Flash Files
Image Caching Test
  • Your site is not using expires headers for your images. An expires tag can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
URL Redirects Checker
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 0
Failed: 1
Warnings: 0
Passed: 1
URL Canonicalization Test
HTTPS Test
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 60
Failed: 2
Warnings: 0
Passed: 4
Microdata Schema Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your page does not use the canonical link tag.
Nofollow Checker
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
Disallow Directive Checker
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF Records Checker
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved