seo site checkup logo
PricingFree ToolsArticles
Report generated 7 years ago
https://www.kenable.co.uk/en
Your general SEO Checkup Score
Archived
100/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 114 out of 100, which is higher than the average score of 75. Our analysis has identified 10 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
10 Failed
1 Warnings
37 Passed
Common SEO issues
Score: 95
Failed: 0
Warnings: 1
Passed: 16
Meta Title
  • Congratulations! Your webpage is using a title tag
Text: Specialists in Cables, HDMI, USB, Audio, Optical, Computer & Networkng
Meta Description
  • Congratulations! Your webpage is using a meta description tag
Text: Cables Specialist. We sell nearly every cable you could ever want! HDMI/USB/Audio/Computer/AV/Network/Ethernet
Google Search Results Preview
Desktop version
https://www.kenable.co.uk/enSpecialists in Cables, HDMI, USB, Audio, Optical, Computer & NetworkngCables Specialist. We sell nearly every cable you could ever want! HDMI/USB/Audio/Computer/AV/Network/Ethernet
Mobile version
https://www.kenable.co.uk/enSpecialists in Cables, HDMI, USB, Audio, Optical, Computer & NetworkngCables Specialist. We sell nearly every cable you could ever want! HDMI/USB/Audio/Computer/AV/Network/Ethernet
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
235price145cable90hdmi75cables45female
Keywords Usage Test
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud
accessoriesadapteradaptersaudiobatteryblackbookbracketbraidedcablecablescameracardscat5ecat5e-ccacctvchargecmosconvertercoppercouplerdatadesklampdevicesdigitaldomedvi-dendsethernetextensionexternalfaceplatesfastfemaleflatgardengoldgreyhdmihighinchindoorjacklamplaptopleadleadslightmainsmalemediametalmicemicromicrophoneminiminiatuemountmountingnetworknetworkingnightopticaloutdoorpatchphonoplugpowerpoweredpriceprinterproductsprofilepulsepurereadingreelreelssatellitesecurityshieldedsocketsolidsonyspeakerspeedsvgaswiveltilittilttypeultrauniversalvarifocalvesavideowallwall-mountedwhitewireless
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your page contains too many H1 tags. H1 tags should re-inforce the intended topic of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 5 H1 tags.
H1 tags
USB 2.0 Active Lead A Male to B Type Printer Plug Boosted Cable 15m
USB 2.0 Panel Mount Female A Socket to A Plug Cable 0.5m 50cm
USB Micro A to USB Micro B 2m Cable Lead
GOLD USB 2.0 Hi-Speed A to mini-B 5 pin Cable Power & Data Lead 1m
USB 2.0 High Speed Cable Printer Lead A to B BLACK 0.3m 30cm
GOLD USB High Speed 24AWG Cable EXTENSION Lead A Plug to Socket 0.3m
USB 2.0 A to A (Male to Male) High-Speed BLACK Cable 3m
GOLD USB 2.0 A To MICRO B FAST CHARGE and Sync Cable 24AWG 1.8m BLACK
CLEAR USB 2.0 A To MICRO B Data and Charging Cable 24AWG 2m Ferrite
BRAIDED Metal Ended GOLD USB 2.0 A To MICRO B Cable 1m SILVER
GOLD USB 2.0 A To MICRO B FAST CHARGE and Sync Cable 24AWG 0.5m BLACK
Mini 4 Pin USB Cable for Kodak Sony Olympus Epson Digital Cameras 1.8m
FLAT USB A To MICRO B TYPE 24AWG FAST CHARGE Cable 3m Lead BLACK
USB 2.0 High Speed Cable Printer Lead A to B BLACK 1.8m
4 Pin Mini USB Male Plug to A type Male USB Plug Camera Cable 1.5m
XBOX ONE or PS4 Charging Lead MICRO B USB 2 Cable Long 3m
USB 2.0 A To MICRO B Data and Charging Shielded Cable 0.5m 50cm RED
USB 2.0 HQ Shielded Cable Lead A Plug to A Plug 3m
BRAIDED Metal Ended GOLD USB 2.0 A To MICRO B Cable 0.15m SILVER
USB 2.0 High Speed Cable Printer Lead A to B 24AWG BLACK 0.6m 60cm
USB 2.0 Type A Male to Type A Female Active Extension Cable 5m
GOLD USB 2.0 A To MICRO B FAST CHARGE and Sync Cable 24AWG 0.25m BLACK
USB 2.0 High Speed Cable EXTENSION Lead A PLug to Socket WHITE 0.5m
USB 2.0 Hi-Speed A to mini-B 5 pin Cable Power & Data Lead 0.15m 15cm
GOLD USB 2.0 High Speed Cable Printer Lead A to B BLACK 0.5m 50cm
USB 2.0 Hi-Speed A to mini-B 5 pin Cable Power & Data Lead 0.5m WHITE
USB 2.0 A to A (Male to Male) High-Speed BLACK Cable 1.8m 6ft
USB 2.0 A To MICRO B Data and Charging Shielded Cable 1m RED
BRAIDED Metal Ended GOLD USB 2.0 A To MICRO B Cable 0.5m SILVER
USB 2.0 High Speed Cable Printer Lead A to B BLACK 3m
External CAT6 Outdoor Use COPPER Ethernet Network Cable Reel UTP 100m
CAT5e UTP COPPER Ethernet Network SOLID Cable Reel 100m - RED
CAT6 Cat 6 UTP COPPER Ethernet Network SOLID Cable Reel BOX 305m
FTP CAT6 Gigabit Ethernet Network COPPER Cable Solid 100m Shielded
FTP CAT5e-CCA Ethernet Network LAN Cable Reel Solid 305m Shielded
Low Smoke CAT5e-CCA LSZH LSOH UTP Ethernet Network Cable Reel Box 305m
External SHIELDED CAT6 Outdoor Use COPPER Ethernet Cable FTP Reel 100m
Cat6 CCA Stranded 24AWG UTP Network UTP Ethernet Cable Reel LSOH 305m
SFX Cat 6 UTP COPPER Ethernet Networking Reel Gigabit Cable 305m
External CAT5e Outdoor Use COPPER Ethernet Network Cable Reel UTP 50m
FTP CAT6 Gigabit Ethernet Network COPPER Cable Solid 305m Shielded
CAT5e UTP COPPER Ethernet Network SOLID Cable Reel 100m - GREEN
Cat 6 UTP COPPER Ethernet Networking Reel Gigabit Cable 305m
External CAT5e-CCA Outdoor Use Ethernet Network Cable Reel UTP 50m
CAT5e UTP COPPER Ethernet Network SOLID Cable Reel BOX 305m - GREY
External CAT5e Outdoor Use COPPER Ethernet Network Cable Reel UTP 305m
Ethernet Cable Reel Network LAN UTP CAT5e-CCA Solid 305m
CAT5e UTP COPPER Ethernet Network SOLID Cable Reel 24AWG 100m
External CAT6 Outdoor Use COPPER Ethernet Network Cable Reel UTP 305m
External CAT5e-CCA Outdoor Ethernet Network Cable Reel Solid UTP 305m
CAT5e UTP COPPER Ethernet Network SOLID Cable Reel BOX 305m - GREEN
External SHIELDED CAT5e Outdoor COPPER Ethernet Cable FTP Reel 305m
Low Smoke CAT5e LSZH LSOH UTP COPPER Ethernet Network Cable Reel 305m
CAT5e UTP COPPER Ethernet Network SOLID Cable Reel BOX 305m - WHITE
CAT6 Cat 6 UTP COPPER Ethernet Network SOLID Cable Reel Wire 50m
External SHIELDED CAT6 Outdoor Use COPPER Ethernet Cable FTP Reel 50m
CAT5e UTP COPPER Ethernet Network SOLID Cable Reel BOX 305m - YELLOW
Low Smoke CAT5e LSZH LSOH UTP COPPER Ethernet Network Cable Reel 100m
CAT5e UTP COPPER Ethernet Network SOLID Cable Reel BOX 305m - RED
Stranded CAT5e-CCA UTP Ethernet Network Cable Reel BOX Wire 305m
PURE HDMI 2.0b 2160p 4k UHD TV Braided High Speed Cable Lead Gold 4m
PURE HDMI 2.0b 2160p 4k UHD TV Braided High Speed Cable Lead Gold 0.5m
PURE HDMI 2.0a 2160p 4k 2k Ultra HD 3D TV Cable Lead Gold Plated 2m
PURE HDMI 2.0a 2160p 4k 2k Ultra HD 3D TV Cable Lead Gold Plated 1.5m
Braided White LED HDMI Cable 4k 2k 3D Support with ARC & Ethernet 5m
Detachable HDMI Cable for Wall Installations & Pre Drilled Holes 1.8m
HDMI 1.4 3D TV High Speed Active Repeater Cable With Ethernet 30m
Detachable HDMI Cable for Wall Installations & Pre Drilled Holes 1m
Braided Chrome HDMI Shielded Cable 4k 2k Supports 3D ARC Ethernet 5m
Newlink OFC HDMI 2.0 4k High Speed Cable Gold for 3D TV 20m
Slim HDMI High Speed 3D TV Low Profile Cable with Ethernet 1m Black
Detachable HDMI Cable for Wall Installations & Pre Drilled Holes 2m
PRO Braided HDMI High Speed 1.4 3D TV Cable Metal Ends 1.5m
PRO Braided HDMI 2.0a 4k2K Ultra UHD TV Cable Metal Ends 2m
PURE HDMI 2.0b 2160p 4k UHD TV Braided High Speed Cable Lead Gold 5m
Braided White LED HDMI Cable 4k 2k 3D Support with ARC & Ethernet 2m
PURE HDMI 2.0a 2160p 4k 2k Ultra HD 3D TV Cable Lead Gold Plated 3m
PURE HDMI 2.0b 2160p 4k UHD TV Braided High Speed Cable Lead Gold 1m
HQ Braided Triple Shielded HDMI High Speed 1.4 3D TV Cable Blue 15m
PRO FLAT Braided HDMI High Speed 1.4 3D TV Cable Metal Ends 50cm 0.5m
Newlink OFC HDMI 2.0 4k High Speed Cable Gold for 3D TV 10m
HDMI 2.0 X Series Premium Lead 4K x 2K UHD Retail Boxed Cable 5m
PRO Braided HDMI High Speed 1.4 3D TV Cable Metal Ends 1.8m
Braided Chrome HDMI Shielded Cable 4k 2k Supports 3D ARC Ethernet 1m
Braided Chrome HDMI Shielded Cable 4k 2k Supports 3D ARC Ethernet 3m
HQ Braided 4k 2k High Speed HDMI 1.4 3D TV Cable Metal Ends 1m
PURE HDMI 2.0b 2160p 4k UHD TV Braided High Speed Cable Lead Gold 3m
PRO FLAT Braided HDMI High Speed 1.4 3D TV Cable Metal Ends 2m
Braided Chrome HDMI Shielded Cable 4k 2k Supports 3D ARC Ethernet 0.5m
Newlink OFC HDMI 2.0 4k High Speed Cable Gold for 3D TV 1.8m
HDMI Digital 1080p to Analogue SVGA 15 Pin Converter Cable with Audio
HDMI Female Socket to DVI-D 25 Pin Male Plug Converter Gold
HDMI Digital 1080p to Analogue SVGA Converter Cable with Audio & USB
HDMI Socket to HDMI Micro and HDMI MINI Plug Multi Use Adapter
PRO VGA Coupler Socket to Socket 15 pin SVGA Joiner Gender Changer
HDMI Steel Wall Plate Mount Faceplate HDMI Socket
HDMI Swivel & Rotatable Adapter Female To Male Plug Adaptor Coupler
PRO HDMI 2.0 Coupler High Speed Joiner Female to Female White
DVI-D 24+1 Female to HDMI Socket Adapter Converter Joiner GOLD
PRO HDMI 2.0 Right Angle Adapter Socket to Plug High Speed 90 Degree
PRO VGA Socket 15 pin to DVI 24+5 Male Plug Video Adapter White
VGA & Audio to HDMI Digital Output ADC Converter with USB Power
Mini-DVI to Female HDMI Adapter Converter Cable for older Macbooks
HDMI Micro D Female Socket to Standard HDMI Plug Adapter Converter
HDMI Horizontal 90 Degree Right Angled Adapter Socket to Plug
HDMI Device to VGA 15 Pin Screen/Projector Converter Video Adapter
DVI-D 24+1 Plug to HDMI Socket Digital Adapter Cable 15cm GOLD
HDMI Coupler Joiner Female to Female - Join 2 cables
HDMI Male Plug to VGA 15 Pin Socket Converter USB Powered with Audio
DVI-D Female 24+1 Socket to HDMI Plug Adapter Converter GOLD
PRO DVI 24+5 Socket to VGA Socket 15 pin Video Coupler Joiner White
DVI-D 24+1 Socket to HDMI Digital Plug Adapter Converter Adapter GOLD
HDMI Male to Female Right Angled Adapter 270 Degrees
HDMI Compact 270 Degree Angled Adapter Female Socket to Male Plug
Rotating Multi-Angle Female HDMI to Male DVI-D Plug 24+1 pin Adapter
PRO DVI 24+1 Socket to HDMI 2.0 Plug Digital High Speed Adapter White
HDMI Double Wall Plate Faceplate Twin Socket For HDMI Cables STEEL
HDMI Female To Female Coupler Joiner Small Compact Adaptor
PRO HDMI MINI C Socket to HDMI 2.0 Plug High Speed Adapter White
HDMI Female Socket to Right Angle HDMI Plug Adapter Converter
PULSE XLR Microphone Male to Female Audio Cable Black 75cm
PULSE XLR Female Socket to 5 Pin DMX Male Plug Adapter Cable 25cm
XLR Microphone Lead Male to Female Audio Cable RED 5m
XLR Microphone Mixer Plug & Socket to 6.35mm Stereo Jack 3m
XLR 3 Pin Male Plug to 2 x 3 Pin XLR Socket Splitter Cable 1.5m
3.5mm Stereo Jack (PC/Laptop) to XLR Female (Mixer/Speaker) Cable 2m
XLR Microphone Male to Female Audio Cable Black 0.5m 50cm
PULSE XLR Microphone Male to Female Audio Cable Black 50m
PRO Microphone Cable XLR Female to Mono Jack 6m Pink
XLR 3 Pin Microphone Lead Male to Female Audio Cable YELLOW 5m
PULSE XLR Microphone Male to Female Audio Cable Black 50cm 0.5m
XLR Microphone Lead Male to Female Audio Cable BLUE 5m
Alctron Audio Interface USB TO XLR PC to Microphone Adapter Cable 3m
5 Pin DMX Plug to 3 Pin XLR Female Plug Audio & Lighting Adapter
XLR Microphone Lead Male to Female Audio Cable RED 4m
3.5mm Stereo Jack (PC/Laptop) to XLR Male (Mixer/Speaker) 2m
XLR 3 Pin Microphone Lead Male to Female Audio Cable YELLOW 10m
Alctron Audio Interface USB to 6.35mm PC to Guitar Adapter Cable 3m
XLR Microphone Male to Female Audio Cable Black 6m
PULSE DMX Shielded Stage XLR Lead 3 Pin Male to Female Cable & Tie 5m
6.35mm Mono Jack Plug to XLR Socket Microphone Cable 2m
XLR Female Plug to Mono 6.35mm Screened OFC Audio Cable YELLOW 6m
PULSE DMX XLR 3 Pin Terminators Black Plugs [2 Pack]
3.5mm Stereo Jack Plug to 3 Pin XLR Plug Audio Cable Lead 6m
Nickel XLR Male Plug To XLR Female Socket Black Cable Lead 20m
Balanced XLR 3 Pin Socket to 6.35mm Male Stereo Jack Plug Cable 3m
XLR Microphone Lead Male to Female Audio Cable RED 10m
PULSE DMX Spiral Shielded Insulated 3 Pin Male to Female Cable 2m
XLR Microphone Lead Male to Female Audio Cable BLUE 2m
PULSE DMX Shielded Stage Lead 5 Pin Male to Female Cable & Tie 3m
B-Sec 4MP Varifocal 4 in 1 Indoor Outdoor CCTV Dome Camera 30m IR
B-Sec 4MP MegaPixel 4 in 1 Indoor Outdoor CCTV Dome Camera 20m IR
STARVIS Varifocal 1080P CCTV 4 in 1 Security Dome Camera 30m IR Grey
5MP Varifocal SONY CMOS 4 in 1 TVI AHD CCTV Dome Camera 30m IR White
STARVIS 1080P CCTV 4 in 1 Security Dome Camera 3.6mm Lens 20m IR Grey
Wireless IP Camera 720p Smartphone Micro SD PIR 2 Way Audio & Zoom
Wireless IP Tilt Pan Zoom Indoor Camera Monitor Smartphone Ready Mic
5MP SONY CMOS 4 in 1 TVI AHD CCTV Security Dome Camera 20m IR Grey
5MP Varifocal SONY CMOS 4 in 1 TVI AHD CCTV Dome Camera 30m IR Grey
AHD 1080p Indoor or Outdoor Day Night 4 in 1 CCTV Bullet Camera 20m IR
STARVIS Varifocal 1080P CCTV 4 in 1 Security Dome Camera 30m IR White
5MP Varifocal SONY CMOS 4 in 1 TVI AHD CCTV Bullet Camera 40m IR Grey
HD SONY CCD 700TVL Indoor PTZ Speed Dome Security Camera 40m IR
CCTV FULL 1080p AHD Dome/Turret Camera Day/Night 3.6mm 20m IR White
720P Dome/Turret INDOOR CCTV 3.6mm Lens 5 In 1 Day/Night Camera White
AHD 720p Indoor or Outdoor Day Night 4 in 1 CCTV Bullet Camera 20m IR
Wireless IP Camera 720p Dome 25m IR Smart Phone Ready with Zoom
5MP SONY CMOS 4 in 1 TVI AHD CCTV Security Dome Camera 20m IR White
AHD 1080p Indoor or Outdoor Day Night 4 in 1 CCTV Dome Camera 20m IR
CCTV FULL 1080p AHD Dome/Turret Camera Day/Night 3.6mm 20m IR Grey
Varifocal SONY CMOS 1080 4 in 1 CCTV Security Dome Camera 30m IR Grey
Wireless IPCam Pan Tilt Indoor CCTV Security IP Camera Webcam 300k
Digital IP Cam 1.0Mp Water-proof Indoor or Outdoor Camera 15m IR
Varifocal SONY CMOS 1080 4 in 1 CCTV Security Dome Camera 30m IR White
STARVIS 1080P CCTV 4 in 1 Security Dome Camera 3.6mm Lens 20m IR White
Single Arm Tilt & Swivel TV Mounting Bracket 14 to 40 Inch Vesa 200
AV Link Slimline VESA LCD Plasma TV Wall Bracket 37 - 60 Inch Screens
Slimline 29mm Fixed TV Bracket for 23 to 42 inch VESA 400 x 300
Desktop TFT LCD Monitor Swivel Arm Desk Stand/Wall Mount
Double Arm & Tilt Cantilever TV Mounting Bracket for 23 to 56 Inch TVs
Double Arm Cantilever Tilt & Swivel Mounting Bracket 10 to 27 Inch TV
Soundbar Mounting Adapter Bracket for Existing TV Brackets Black
Tempered Glass 5mm Wall Mount Media Shelf DVD / Satellite Box Black
Universal Pedestal Swivel & Tilt TV Stand Glass for 32 to 55 inch TVs
Projector Ceiling Mount Bracket with Adjustable Tilt & Rotate upto 8kg
Full Motion Gas Sprung Desktop Monitor Mount for 10 to 27 Inch TVs
Universal Tilting Wall Mount Plasma LCD TV 23-37 Inch
Double Arm & Tilt Cantilever TV Mounting Bracket for 32 to 65 Inch TVs
Universal Tilting TV Mounting Bracket 30mm Profile 24-42 inch VESA 200
TV Ceiling Bracket for LCD/LED TV Monitor - VESA 75/100/200
Wall Mounting Black Swivel Speaker Bracket 37 Degree Tilt
Universal Fixed TV Mounting Bracket 23mm Profile 24-42 inch VESA 200
Low Profile Fixed TV Mounting Bracket 5mm Profile 26-55 Inch VESA 400
Low Profile Fixed TV Mounting Bracket 11mm Profile 32-70 Inch VESA 600
TruVue TV LCD LED Wall Swinging & Tilting Arm Bracket 10-24 inch
Media Box Mounting Adapter Bracket for Existing TV Brackets Black
LED/LCD Large TV Slimline Bracket Over 65 Inch Televisions upto 65kg
Desktop LCD Monitor DUAL Adjustable Arm Bracket With Stand
Universal Fixed TV Mounting Bracket 23mm Profile 32-65 TVs Max 50kg
Tilt and Swivel TV Mounting Bracket 56mm Profile for 14 to 40 Inch TVs
Dual Arm Tilt and Swivel TV Wall Mounting Bracket 32 to 65 Inch TVs
Wall Mounting White Universal Speaker Bracket 72 x 38 x 42mm
Universal Tilting TV Mounting Bracket 32-65 inch VESA 600x400
TechLink Universal LCD Wall Mount Ultra Slim Profile for 23-37 inch TV
Wall Mount Universal Guitar Holding Bracket with Cushioned Arms
Battery Powered LED Light Bulb 50 Lumens Sheds Tents Cupboards Pink
Wall-Mounted Lamp Outdoor Oval Bulkhead E27 Light IP44 Black
2 Watt LED Ultra Bright Light with Adjustable Beam Angle and Headstrap
Wireless LED Motion Sensor 360 Degree Weatherproof SMD LED Light Black
Warm White LOVE Indoor Decoration Mains Powered LED Light Large
LED E27/ES GLS 11W 1000lm 4000k Lamp Screw-in Bulb Cool White
Wireless LED Motion Sensor 360 Degree Weatherproof SMD LED Light White
Halloween Spooky Effects Weatherproof IP44 Garden Projector Light 5m
Wall-Mounted Lamp Outdoor Garden Light with Dusk to Dawn Sensor Black
Miniatue 10cm Desklamp Reading Book Swivel & Tilit Night Light Pink
Wall-Mounted Outdoor IP44 Lantern Style Garden Lamp E27 Light Black
50W LED Security Light 240V IP65 Tilting Outdoor 6000K Floodlight
Wall-Mounted Lamp Outdoor Garden Light with Dusk to Dawn Sensor White
Battery Powered LED Light Bulb 50 Lumens for Sheds Tents Cupboards
Wall or Ceiling Mount LED Moonglow Moving Light 6x 1W LEDs with PSU
Motion Sensored UK Mains Power LED Night Light 4000k Natural White
Battery Powered LED Light Bulb 50 Lumens Sheds Tents Cupboards Red
Warm White LOVE Indoor Decoration Battery Powered LED Light Small
Warm White LOVE HEART Indoor Decoration Battery Powered LED Light
LED 4W Energy Saving Light Bulb E27 Candle Filament 2700k Warm WhiteUK
Wall-Mounted GU10 Down Light Outdoor IP44 Garden Squared Lamp Black
Wall-Mounted Outdoor Garden Lamp IP44 Hanging Lantern E27 Light Black
Warm White HAPPY Indoor Decoration Battery Powered LED Light Small
Warm White HOME Indoor Decoration Mains Powered LED Light Large
Wall-Mounted Outdoor Lantern Style Lamp Garden Light 250x165 Black
Motion Sensored Battery Powered Twin LED Security Flood Light with PIR
Miniatue 10cm Desklamp Reading Book Swivel & Tilit Night Light Black
Wall-Mounted GU10 Down Light Outdoor IP44 Garden Rounded Lamp Black
Miniatue 10cm Desklamp Reading Book Swivel & Tilit Night Light Blue
24 LED Hook & Magnetic Mounting Ultra Bright Work Lamp Torch UK
Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! Your website has a sitemap file.
Image Alt Test
  • All of your webpage's "img" tags have the required "alt" attribute.
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your webpage.
Speed optimizations
Score: 47
Failed: 5
Warnings: 0
Passed: 3
HTML Page Size Test
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 605.7 Kb to 40.87 Kb (93% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 12.21 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 291
  • 2 HTML Pages
  • 2 CSS Files
  • 11 JS Files
  • 276 Images
  • 0 Flash Files
Image Caching Test
  • Congratulations! Your webpage is using cache headers for your images and the browsers will display these images from the cache.
JavaScript Minification Test
  • Congratulations! Your website's JavaScript files are minified!
See results list
CSS Minification Test
  • Some of your website's CSS files are not minified!
See results list
URL Redirects Checker
  • Your URL performed 3 redirects! Avoid chained redirects if possible, as this may cause search engine indexing problems and adversely affect site loading time.
Server and security
Score: 80
Failed: 1
Warnings: 0
Passed: 2
URL Canonicalization Test
HTTPS Test
Plaintext Emails Test
  • We've found 1 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 80
Failed: 2
Warnings: 0
Passed: 4
Microdata Schema Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your webpage does not use the canonical link tag.
Nofollow Checker
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
See results list
Disallow Directive Checker
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF records checker
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2026 • All rights reserved