seo site checkup logo
PricingFree ToolsArticles
Report generated 8 years ago
https://kdimportados.com.br
Your general SEO Checkup Score
Archived
99/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 99 out of 100, which is higher than the average score of 75. Our analysis has identified 10 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
10 Failed
1 Warnings
36 Passed
Common SEO issues
Score: 75
Failed: 2
Warnings: 1
Passed: 14
Meta Title
  • Congratulations! Your webpage is using a title tag
Text: Acessórios para telemóvel - Compre Acessórios Para Carros KD Importados - Produtos Importados - Pronta Entrega
Meta Description
  • Congratulations! Your webpage is using a meta description tag
Text: Loja de Produtos importados a Pronta Entrega no Brasil, com preços justos e agilidade na entrega.
Google Search Results Preview
Desktop version
https://kdimportados.com.brAcessórios para telemóvel - Compre Acessórios Para Carros KD Importados - Produtos Importados - Pronta EntregaLoja de Produtos importados a Pronta Entrega no Brasil, com preços justos e agilidade na entrega.
Mobile version
https://kdimportados.com.brAcessórios para telemóvel - Compre Acessórios Para Carros KD Importados - Produtos Importados - Pronta EntregaLoja de Produtos importados a Pronta Entrega no Brasil, com preços justos e agilidade na entrega.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
38visualização38rápida35comprar12para12options
Keywords Usage Test
  • Your most common keywords are not appearing in one or more of the meta-tags above. Your primary keywords should appear in your meta-tags to help identify the topic of your webpage to search engines.
Keyword(s) included in Title tag
Keyword(s) not included in Meta-Description tag
Keywords Cloud
acessóriosaltaaquarioartificalautomotivobaixabateriabrowsercalçacapacarrinhocarroscasecatracacelularescerachavechocadeiracomocompararcomprarcompressãocondicionadocontacontatocromocustomerdadosdaguadentesdigitaldisabledemailengateenvioestoquefotográficofrogfundogeladeiragestantegramposgrandhabilitarinformaçõesiphoneiscasjavascriptkendallleialinksysmaismaquiagemmeiameusminhamédianossoofertasoptionspagamentopap2tparapescaponteiraprecisapremiumpreçopreçospriceprixproteçãoprovarapidoresetarreversivarápidasaposegurosejasiliconesilispongesitesobresoquetespecialstudio/estudiotermometrotermostermostatotodastodotodostradicionaltrocavanadiumvejavisualizaçãovoipvoltímetro
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your webpage does not contain any H1 headings. H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
TOP CATEGORIAS
Produtos em Destaque
Capa à Prova Dagua P/ Todos Celulares
Engate Rapido De Alta E Baixa Ar Condicionado Automotivo
Folha de Sulfite A4 CHAMEX
Grampos Fundo Fotográfico Studio/estudio
Chave Catraca Reversiva 1/2 Soquete 24 Dentes Cromo Vanadium
Termometro Termostato Digital Aquario Geladeira chocadeira
Meia Calça Kendall Gestante Média Compressão Mel Sem Ponteira
Silisponge Esponja De Silicone
Cera Grand Prix Tradicional 200g
Voltímetro Digital Automotivo 12-24v Bateria
Case Premium Iphone 6 e 6s Proteção 360°
Voltimetro Amp Termômetro Carregador Veicular Usb | 12v 24v
Chegaram Recentemente
Meia Longa 7/8 Kendall Média Compressão Renda com Silicone sem Ponteira
Meia 3/4 Kendall Alta Compressão Masculina
Voltímetro E Amperímetro Digital Lcd 130-500v + 50a Ac + Tc
Chuveirinho Para Pesca C/ 5 Anzóis Tamanho 9 Albatroz 2 Unid
Molinete De Pesca Lf5000 8 Rolamento Carretel Aluminio 4.9:1
Voltímetro e Amperimetro Digital Dc 200v 200a Com Shunt
Boia Pena Luminosa Para Pesca - Kit C/02pç Com Pilha
Alicate de Pesca com Bico de Troca Garatéia
Cera Limpadora ACDELCO 200g
Kit 5 Iscas Artifical Para Pesca Sapo Frog 5.5cm
Mais Vendidos
Customer Support
Pagamento Seguro
Returns
Nosso Blog
Silisponge Maquiagem
Como Resetar o Linksys PAP2T
Mais Visualizados
Adaptador Voip Ata Linksys Pap2t 2 FXS
Luva Anti-Corte com Fio De Aço Inoxidável Para Proteção
Robots.txt Test
  • This website is using a robots.txt file.
Image Alt Test
  • Your webpage contains "img" tags without the required "alt" atribute.
See full list
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your webpage.
Speed optimizations
Score: 47
Failed: 4
Warnings: 0
Passed: 4
HTML Page Size Test
  • Congratulations! The size of your webpage's HTML is 18.39 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 141.55 Kb to 18.39 Kb (87% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 7.04 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 147
  • 1 HTML Pages
  • 37 CSS Files
  • 45 JS Files
  • 64 Images
  • 0 Flash Files
Image Caching Test
  • Congratulations! Your webpage is using cache headers for your images and the browsers will display these images from the cache.
JavaScript Minification Test
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test
  • Some of your website's CSS files are not minified!
See results list
URL Redirects Checker
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 80
Failed: 1
Warnings: 0
Passed: 2
URL Canonicalization Test
HTTPS Test
Plaintext Emails Test
  • We've found 2 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 80
Failed: 1
Warnings: 0
Passed: 5
Microdata Schema Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your webpage does not use the canonical link tag.
Nofollow Checker
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Checker
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF records checker
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 a mx ip4:165.227.184.180 ~all

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2026 • All rights reserved