seo site checkup logo
PricingFree ToolsArticles
Report generated 7 years ago
http://kalyanammatrimony.org
Your general SEO Checkup Score
Archived
100/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 105 out of 100, which is higher than the average score of 75. Our analysis has identified 10 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
10 Failed
0 Warnings
38 Passed
Common SEO issues
Score: 100
Failed: 0
Warnings: 0
Passed: 17
Meta Title
  • Congratulations! Your webpage is using a title tag
Text: Best Matrimonial in Chennai | Marriage portal - Kalyanam Matrimony
Meta Description
  • Congratulations! Your webpage is using a meta description tag
Text: Best Matrimonial site in India offering matrimonial services for all religions, languages, caste & communities. Register FREE & find your perfect match
Google Search Results Preview
Desktop version
http://kalyanammatrimony.orgBest Matrimonial in Chennai | Marriage portal - Kalyanam MatrimonyBest Matrimonial site in India offering matrimonial services for all religions, languages, caste & communities. Register FREE & find your perfect match
Mobile version
http://kalyanammatrimony.orgBest Matrimonial in Chennai | Marriage portal - Kalyanam MatrimonyBest Matrimonial site in India offering matrimonial services for all religions, languages, caste & communities. Register FREE & find your perfect match
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
8matrimony4mobile4match3password3kalyanam
Keywords Usage Test
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud
accordingaccountachievedagreeallowassameseauthenticitybengalibestbirthbridecarescastechoosingcommunityconditionscontinuecountrycouplecreatecredibilitydatedivisione-mailensurefamilyfemaleforgotfreegendergoalsgreetedgroomgujaratihandshelphidinghindihistoryhomeindiajoiningkalyanamkannadaleadinglifelivingloginlovemakingmalayaleemalemandatorymarathimarwadimatchmatchesmatematrimonialmatrimonymembershipmobilemothernavigationnumberoptionoriyaparsipasswordpersonplanplannerspolicyportalprivacyprofileprofilespunjabiregisterreligionsearchseekingservicessindhisoulspecialspecialitysuccessfultamiltelugutermstoggletonguetrustedurduusername/e-mailverificationverifiedweddingwelcome
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Congratulations! Your webpage contains headings tags.
H1 tags
The Most Trusted& Successful Matrimony Portal
H2 tags
Find someone who cares for what you love!
Search Your Special Someone Here
Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! Your website has a sitemap file.
Image Alt Test
  • All of your webpage's "img" tags have the required "alt" attribute.
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your webpage.
Speed optimizations
Score: 28
Failed: 5
Warnings: 0
Passed: 3
HTML Page Size Test
HTML Compression/GZIP Test
  • Your webpage doesn't use any HTML compression! You should compress your HTML to reduce your page size and page loading times - this will help your site retain visitors and increase page views. If you were using compression, you could be compressing your HTML size by 78% - from 111.04 Kb to 24.81 Kb .
Site Loading Speed Test
  • Your website loading time is around 3.96 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 53
  • 1 HTML Pages
  • 19 CSS Files
  • 19 JS Files
  • 14 Images
  • 0 Flash Files
Image Caching Test
  • Congratulations! Your webpage is using cache headers for your images and the browsers will display these images from the cache.
JavaScript Minification Test
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test
  • Some of your website's CSS files are not minified!
See results list
URL Redirects Checker
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 0
Failed: 3
Warnings: 0
Passed: 0
URL Canonicalization Test
HTTPS Test
Plaintext Emails Test
  • We've found 1 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 100
Failed: 0
Warnings: 0
Passed: 6
Microdata Schema Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your webpage does not use the canonical link tag.
Nofollow Checker
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Checker
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF records checker
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 ip4:46.105.228.191 ip4:63.141.246.28 +a +mx +ip4:178.33.235.187 ~all

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2026 • All rights reserved