seo site checkup logo
PricingFree ToolsArticles
Report generated 3 years ago
https://www.infozion.in
Your general SEO Checkup Score
Archived
73/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 73 out of 100, which is below the average score of 75. However, there are 15 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
15 Failed
7 Warnings
47 Passed
Common SEO issues
Score: 64
Failed: 6
Warnings: 3
Passed: 16
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Home - Infozion Technologies
Length: 28 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 348 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Blueprint of Our Process At Infozion, we follow a streamlined procedure as given below to understand your needs and provide you the most effective solution to address the concerns. 01 Comprehending your requirement Our adept team will first analyse and understand your concerns to technically decode the best possible way to help you reach your […]
Length: 348 characters
Google Search Results Preview Test
Desktop version
https://www.infozion.inHome - Infozion TechnologiesBlueprint of Our Process At Infozion, we follow a streamlined procedure as given below to understand your needs and provide you the most effective solution to address the concerns. 01 Comprehending your requirement Our adept team will first analyse and understand your concerns to technically decode the best possible way to help you reach your […]
Mobile version
https://www.infozion.inHome - Infozion TechnologiesBlueprint of Our Process At Infozion, we follow a streamlined procedure as given below to understand your needs and provide you the most effective solution to address the concerns. 01 Comprehending your requirement Our adept team will first analyse and understand your concerns to technically decode the best possible way to help you reach your […]
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
en_US
og:type
website
og:title
Home - Infozion Technologies
og:description
Blueprint of Our Process At Infozion, we follow a streamlined procedure as given below to understand your needs and provide you the most effective solution to address the concerns. 01 Comprehending your requirement Our adept team will first analyse and understand your concerns to technically decode the best possible way to help you reach your …
og:url
https://www.infozion.in/
og:site_name
Infozion Technologies
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
40infozion33business32development25services19help
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
infozion
business
development
services
help
Keywords Cloud Test
achieveaffordableafricanamericanapplicationapplicationsappsaudiencebackendbestbetterbrandbrandsbusinessbusinessesclientscodescomecommercecompanycontactcreatecreationcustomcustomerdedicateddeliverdeliverydevelopersdevelopmentdigitaleasiereffectiveenhancingexperienceexplorefasterframeworksfriendlygivengrowhaveheightshelphelpedhelpshighlyhireideasinfozioninnovativeissuesjustknowleadslikelovemakemanagemanagedmanagementmarketingmobileneedsperformancepointportfolioprojectprojectsprovideprovidesqualityreachrequirementsretailseamlesslyserviceservicessoftwaresolutionsolutionsspacespectacularstrategiesstreamlinedsuresweetiesteamtechnologicaltechnologiestechnologytimeunderstanduserusingvariousviewwebsiteworkworld
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Infozion is where your growth starts!
H2 tags
DigitalTransformation
CRMDevelopment
UX Research andStrategy
PerformanceOptimisation
Services
App Development
About Us
We are here to provide you the best
Digital Marketing Services
Web App Development
Custom App Development
Software Enhancing
SEO Services
UI/UX Creation
Blueprint of Our Process
A service that will simplify your business
We create Technical heart of your product
Find all your Development needs only at Infozion
Why Hire Developers from Infozion ?
Technologies & Frameworks Our Developers Skilled In
Explore Our Recent Case Studies
Trusted by Clients All over World
Let’s Grab A Cup Of Coffee and Discuss Something Cool!
Faq's
Awards
Some of the brightest brands trust us already !
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
SEO Friendly URL Test40% of top 100 sites passed
  • This webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test38% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Inline CSS Test2% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test80% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook Twitter 
Speed optimizations
Score: 72
Failed: 5
Warnings: 4
Passed: 14
HTML Page Size Test34% of top 100 sites passed
  • The size of this webpage's HTML is 22.35 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 7,643 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 156.69 Kb to 22.35 Kb (86% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 4.82 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
83.3 %
2.88 Mb
javascript
7.6 %
267.59 Kb
font
4.0 %
140.10 Kb
css
3.5 %
122.57 Kb
html
1.2 %
42.47 Kb
other
0.5 %
17.96 Kb
TOTAL
100%
3.46 Mb
Requests by content type
Content type
Percent
Requests
image
63.4 %
71
css
14.3 %
16
javascript
13.4 %
15
font
5.4 %
6
html
1.8 %
2
other
1.8 %
2
TOTAL
100%
112
Content size by domain
Domain
Percent
Size
infozion.in
89.5 %
3.10 Mb
gstatic.com
5.1 %
181.46 Kb
fonts.gstatic.com
2.4 %
84.36 Kb
maxcdn.bootstrapcdn.com
1.6 %
55.74 Kb
google.com
1.1 %
40.68 Kb
stackpath.bootstrapcdn.com
0.2 %
7.35 Kb
fonts.googleapis.com
0.0 %
1018 B
TOTAL
100%
3.46 Mb
Requests by domain
Domain
Percent
Requests
infozion.in
86.6 %
97
fonts.gstatic.com
4.5 %
5
google.com
3.6 %
4
gstatic.com
2.7 %
3
stackpath.bootstrapcdn.com
0.9 %
1
fonts.googleapis.com
0.9 %
1
maxcdn.bootstrapcdn.com
0.9 %
1
TOTAL
100%
112
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test99% of top 100 sites passed
See results list
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test93% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test97% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • This URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 3.58 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

3.58 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img src="https://www.infozion.in/wp-content/uploads/2021/03..." alt="Banner">
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.028. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.

0.0281

0.1

0.25

DOM element which contributes the most to CLS score:
Text: We are here to provide you the best Here’s a glimpse of what we do to help you ...
Html: <div class="site-content-wrapper">
Score: 0.0249
Server and security
Score: 89
Failed: 2
Warnings: 0
Passed: 7
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.infozion.in" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
infozion.in
Subject Alternative Names (SANs)
infozion.in, *.infozion.in
Not valid before
Mon, July 4o 2022, 12:00:00 am (z)
Not valid after
Wed, August 2o 2023, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Amazon
Intermediate certificate
Common name
Amazon
Organization
Amazon
Location
US
Not valid before
Thu, October 22o 2015, 12:00:00 am (z)
Not valid after
Sun, October 19o 2025, 12:00:00 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Amazon Root CA 1
Root certificate
Common name
Amazon Root CA 1
Organization
Amazon
Location
US
Not valid before
Tue, May 26o 2015, 12:00:00 am (z)
Not valid after
Sun, January 17o 2038, 12:00:00 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Amazon Root CA 1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test93% of top 100 sites passed
  • We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 65
Failed: 2
Warnings: 0
Passed: 7
Structured Data Test59% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.infozion.in is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.infozion.in/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • The robots.txt file does not use the disallow directive. This means that the whole website can be crawled by search engines.
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:zoho.com include:_spf.freshsales.io include:sendgrid.net ip4:149.72.243.235 ip4:149.72.145.7 ~all
Ads.txt Validation Test80% of top 100 sites passed
  • The access to the ads.txt file is restricted! Our request for this resource has returned a {status_code} HTTP status code. In order for this resource to be easily accessed by the DSPs and advertisers, its status code should be 200 OK.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved