seo site checkup logo
PricingFree ToolsArticles
Report generated 2 years ago
https://indra-foundation.org
Your general SEO Checkup Score
Archived
76/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 76 out of 100, which is higher than the average score of 75. Our analysis has identified 13 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
13 Failed
6 Warnings
53 Passed
Issues to fix
HIGH
Consider using structured data in your webpage as it can help search engines gain a better understanding of your content.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
HIGH
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
LOW
Replace deprecated HTML tags with their modern equivalents or appropriate CSS rules.
Common SEO issues
Score: 81
Failed: 4
Warnings: 2
Passed: 20
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Volunteer in Nepal with Indra Foundation Community Projects
Length: 59 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Volunteer in Nepal with Indra Foundation to work with grassroots level community based volunteering projects in Nepal for making a real difference in Life!
Length: 155 characters
Google Search Results Preview Test
Desktop version
https://www.indra-foundation.org/Volunteer in Nepal with Indra Foundation Community ProjectsVolunteer in Nepal with Indra Foundation to work with grassroots level community based volunteering projects in Nepal for making a real difference in Life!
Mobile version
https://www.indra-foundation.org/Volunteer in Nepal with Indra Foundation Community ProjectsVolunteer in Nepal with Indra Foundation to work with grassroots level community based volunteering projects in Nepal for making a real difference in Life!
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
en_US
og:type
website
og:title
Volunteer in Nepal with Indra Foundation Community Projects
og:description
Volunteer in Nepal with Indra Foundation to work with grassroots level community based volunteering projects in Nepal for making a real difference in Life!
og:keywords
volunteer in nepal, volunteer nepal, volunteering projects nepal, internship in nepal, gap year nepal,
og:url
https://www.indra-foundation.org/
og:site_name
Indra Foundation
og:updated_time
2023-06-09T06:10:14+05:45
og:image
https://www.indra-foundation.org/images/slider/indra-foundation-slider-1.jpg
og:image:alt
volunteer in nepal with Indra Foundation
og:image:type
image/jpeg
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
30nepal25indra23foundation19read12programs
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
nepal
indra
foundation
read
programs
Keywords Cloud Test
abroadagriculturearrivingaugustbasedbettermentchancecharitablechildrenchinacoffeecommunitiescommunitycontactcornerscountryculturedesigneddevelopmentexperiencefarmfarmingfeesfocusingfoundationgavegermanyglancedgroupshalfhearthelpedhonestlyimproveindraintegrateinterestinginternshipjoinkathmandukingdomlifelifestylelifetimelikelindalivelihoodlivelihoodslivingmeaningfulmicrofinancemonthmurmurednepaloffersorganicorganizationprogramprogramsprojectprojectsreadreallyreceivedrecognizeresearchreviewsroomruralsethshortsillsocialstandsummertargettermtimetokentourismtravelunitedvaluesvariousviewvisitedvolunteervolunteeringweekswelcomewelcomingwentwindowwomenwordworkworkingwouldnyearziyan
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Indra Foundation
Reviews
Our Blog
Explore Nepal
H2 tags
Welcome to
Volunteer in Nepal with
Livelihood Development Project
Rural Life Experience Program
Community Tourism Project
Internship in Nepal with
Tea Research & Agriculture
Micro Finance & Rural Development
Coffee Research & Farm Work
Community Projects of
Program
Read
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
  • This website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test40% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test38% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Inline CSS Test2% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • We found some HTML deprecated tags! You are advised to change these old tags with equivalent tags or proper CSS rules.
5center
Google Analytics Test69% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test80% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook Twitter 
Speed optimizations
Score: 68
Failed: 6
Warnings: 3
Passed: 14
HTML Page Size Test34% of top 100 sites passed
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,562 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 170.77 Kb to 34.17 Kb (80% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 4.06 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
93.1 %
7.19 Mb
font
3.7 %
295.26 Kb
javascript
2.2 %
172.12 Kb
css
0.9 %
71.40 Kb
html
0.1 %
6.77 Kb
other
0.0 %
210 B
TOTAL
100%
7.73 Mb
Requests by content type
Content type
Percent
Requests
image
60.0 %
36
css
16.7 %
10
javascript
11.7 %
7
font
8.3 %
5
html
1.7 %
1
other
1.7 %
1
TOTAL
100%
60
Content size by domain
Domain
Percent
Size
indra-foundation.org
94.0 %
7.26 Mb
ka-f.fontawesome.com
3.6 %
283.25 Kb
googletagmanager.com
1.1 %
88.31 Kb
cdn.jsdelivr.net
0.7 %
54.35 Kb
fonts.gstatic.com
0.5 %
41.78 Kb
cdnjs.cloudflare.com
0.1 %
4.76 Kb
kit.fontawesome.com
0.1 %
4.53 Kb
fonts.googleapis.com
0.0 %
994 B
google-analytics.com
0.0 %
210 B
TOTAL
100%
7.73 Mb
Requests by domain
Domain
Percent
Requests
indra-foundation.org
73.3 %
44
ka-f.fontawesome.com
10.0 %
6
fonts.gstatic.com
5.0 %
3
cdn.jsdelivr.net
3.3 %
2
googletagmanager.com
1.7 %
1
kit.fontawesome.com
1.7 %
1
cdnjs.cloudflare.com
1.7 %
1
fonts.googleapis.com
1.7 %
1
google-analytics.com
1.7 %
1
TOTAL
100%
60
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test99% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test93% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test97% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • This URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 1.24 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

1.24 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img src="images/slider/indra-foundation-slider-1.jpg" class="d-block w-100" alt="indra-foundation">
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.12. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.

0.1204

0.1

0.25

DOM element which contributes the most to CLS score:
Html: <div class="carousel-inner">
Score: 0.1062
Server and security
Score: 93
Failed: 1
Warnings: 0
Passed: 9
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.indra-foundation.org" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.indra-foundation.org
Subject Alternative Names (SANs)
*.indra-foundation.org, indra-foundation.org
Not valid before
Tue, May 23o 2023, 9:00:11 am (z)
Not valid after
Mon, August 21o 2023, 9:00:10 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R3
Intermediate certificate
Common name
R3
Organization
Let's Encrypt
Location
US
Not valid before
Fri, September 4o 2020, 12:00:00 am (z)
Not valid after
Mon, September 15o 2025, 4:00:00 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=31536000; includesubdomains; preload
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test93% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 37
Failed: 2
Warnings: 1
Passed: 7
Structured Data Test59% of top 100 sites passed
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.indra-foundation.org/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.indra-foundation.org/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 +a +mx +ip4:65.60.35.102 ~all
Ads.txt Validation Test80% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved