seo site checkup logo
PricingFree ToolsArticles
Report generated 10 years ago
http://in.musafir.com/Flights/Default.aspx
Your general SEO Checkup Score
Archived
100/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 109 out of 100, which is higher than the average score of 75. Our analysis has identified 8 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
8 Failed
2 Warnings
28 Passed
Common SEO issues
Score: 92
Failed: 0
Warnings: 1
Passed: 11
Google Search Results Preview
Desktop version
http://in.musafir.com/Flights/Default.aspx Air Ticket - Domestic Flights Air Ticket Booking ₹ 1,750 onwards Air ticket booking @ ₹ 1,750 onwards with in.musafir.com. Get great flight ticket deals on online air ticket bookings. We assure the lowest prices on Domestic & International Flight tickets.
Mobile version
http://in.musafir.com/Flights/Default.aspx Air Ticket - Domestic Flights Air Ticket Booking ₹ 1,750 onwards Air ticket booking @ ₹ 1,750 onwards with in.musafir.com. Get great flight ticket deals on online air ticket bookings. We assure the lowest prices on Domestic & International Flight tickets.
Keywords Cloud
adultsadventureaheadairlinesairwaysandamanavailbackcloseforwardbangalorebestbookboredbusinesschennaichildchildrenchosenclasscomfortablecontactcountlessdaysdelhidesirediscountsdomesticdownloaddubaieconomyegyptetihadexperienceexplorationflightflightsfollowgoairgooglehardhigherholidayshotelhotelshustleindiaindigointernationalkualalankalifelinkedinlivinglumpurmalaysiamauritiusmeanmomentsmumbaimusafirmusafir.comofferedofferspackagespatnapeopleplanpocketpolicypreferpreviousprivacyqatarrajasthanranchiroomroundroyalsachinsingaporesmartspectacularspicejetstandardtermsthaithailandticketticketsticket withtimetourtraveltravellingtripturkishutilisevisavisasvishakhapatanamwasting
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
Image Alt Test
  • Your webpage has 15 'img' tags and 2 of them are missing the required 'alt' attribute.
See full list
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your website is using the asynchronous version of Google Analytics tracking code.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulation! There is no occurrence of any severe JavaScript Errors in your web page.
Speed optimizations
Score: 66
Failed: 2
Warnings: 1
Passed: 2
HTML Page Size Test
  • Congratulations! Your HTML size is 10.79 Kb and this is under the average web page size of 33 Kb.
    This leads to a faster page loading time than average.
HTML Compression/GZIP Test
  • Congratulations! Your page is successfully compressed using gzip compression on your code.
    Your HTML is compressed from 50.75 Kb to 10.79 Kb (79 % size savings). This helps ensure a faster loading web page and improved user experience.
Site Loading Speed Test
  • Your site loading time is around 15.087 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 112
  • 14 HTML Pages
  • 4 CSS Files
  • 20 JS Files
  • 74 Images
  • 0 Flash Files
Image Caching Test
  • Your site is not using expires headers for all of your images. An expires tag can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
Server and security
Score: 0
Failed: 0
Warnings: 0
Passed: 2
HTTPS Test
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 0
Failed: 1
Warnings: 0
Passed: 1
Media Query Responsive Test
  • Your website is not using media queries. You should consider using this technique in order to implement responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 38
Failed: 2
Warnings: 0
Passed: 3
Microdata Schema Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your webpage is using the canonical link tag. This means that your webpage is not the preferred one to use in the search results.
<link rel="canonical" href="http://in.musafir.com/Flights/Default.aspx" />
Nofollow Checker
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
Disallow Directive Checker
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved