seo site checkup logo
PricingFree ToolsArticles
Report generated 8 years ago
http://ibmrbschool.org
Your general SEO Checkup Score
Archived
64/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 64 out of 100, which is below the average score of 75. However, there are 13 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
13 Failed
1 Warnings
27 Passed
Common SEO issues
Score: 61
Failed: 4
Warnings: 0
Passed: 11
Google Search Results Preview
Desktop version
http://ibmrbschool.org/IBMR,IBMR-Home,BSCHOOLS,B-SCHOOLS,BBA,MBA,Founded in 1999, Institute of Business Management and Research (IBMR) was envisioned as an autonomous Institution, dedicated to benefitting an entire spectrum of career aspirants by developing and delivering study programmes that extend beyond the limitations of traditional classrooms; emphasise the broader appreciation of organisations extending beyond the range of present responsibilities; and have true global relevance.
Mobile version
http://ibmrbschool.org/IBMR,IBMR-Home,BSCHOOLS,B-SCHOOLS,BBA,MBA,Founded in 1999, Institute of Business Management and Research (IBMR) was envisioned as an autonomous Institution, dedicated to benefitting an entire spectrum of career aspirants by developing and delivering study programmes that extend beyond the limitations of traditional classrooms; emphasise the broader appreciation of organisations extending beyond the range of present responsibilities; and have true global relevance.
Keywords Cloud
achievedalliancesbaronbusinesscontactdalalexperiencehomeibmrindiaindianjournallifemarchmovieplacementsrankedrecentlyschoolschoolssitemapsourcestreetsurveyteam
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test
  • Congratulations! We've found 1 sitemap file for your website:
SEO Friendly URL Test
  • We have found 10 URLs that are not SEO friendly!
See results list
Image Alt Test
  • Your webpage has 33 'img' tags and none of them contain the required 'alt' attribute.
See full list
Inline CSS Test
  • Congratulations! Your web page does not use inline CSS styles.
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your website is using the latest version of Google Analytics.
Favicon Test
  • Your site either doesn't have a favicon or this has not been referenced correctly.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your web page.
Social Media Check
  • Congratulations! Your website is connected successfully with social media using: Facebook;
Speed optimizations
Score: 55
Failed: 5
Warnings: 1
Passed: 5
HTML Page Size Test
HTML Compression/GZIP Test
  • Your page do not use any HTML compression!
    You should compress your HTML to reduce your page size and page loading times - this will help your site retain visitors and increase page views. If you were using compression, you could be compressing your HTML size by 73 % - from 22.47 Kb to 5.98 Kb which would further reduce your page loading time.
Site Loading Speed Test
  • Your site loading time is around 3.577 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 57
  • 3 HTML Pages
  • 2 CSS Files
  • 4 JS Files
  • 45 Images
  • 3 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Warning: your website contains flash objects. Flash is an outdated technology that is used to deliver rich multimedia content. Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
See results list
Image Caching Test
  • Your site is not using expires headers for all of your images. An expires tag can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
Nested Tables Test
  • It appears that your site contains nested tables. Nested tables can be slow to render in some browsers. Consider using a CSS layout to reduce both HTML size and page loading time.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Your website does not have a doctype declaration and this may cause rendering problems!
URL Redirects Checker
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 66
Failed: 2
Warnings: 0
Passed: 4
URL Canonicalization Test
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 0
Failed: 1
Warnings: 0
Passed: 1
Media Query Responsive Test
  • Your website is not using media queries. You should consider using this technique in order to implement responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 80
Failed: 1
Warnings: 0
Passed: 5
Microdata Schema Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your page does not use the canonical link tag.
Nofollow Checker
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Checker
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
SPF records checker
  • Congratulations! Your DNS server is using an SPF record. This SPF record is listed below:
v=spf1 ip4:94.75.240.183 +a +mx ~all

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved