seo site checkup logo
PricingFree ToolsArticles
Report generated 7 years ago
https://healthplus.com.pk
Your general SEO Checkup Score
Archived
74/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 74 out of 100, which is below the average score of 75. However, there are 12 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
12 Failed
1 Warnings
35 Passed
Common SEO issues
Score: 73
Failed: 4
Warnings: 1
Passed: 15
Meta Title
  • Congratulations! Your webpage is using a title tag
Text: Pakistan's Best Online Fitness & Bodybuilding Supplement Store | Health Plus
Meta Description
  • Congratulations! Your webpage is using a meta description tag
Text: Health Plus is Pakistan's best online store that offers Dietary/Food Supplements, Vitamins, Protein and Bodybuilding Supplement in Pakistan, we have all.
Google Search Results Preview
Desktop version
https://healthplus.com.pkPakistan's Best Online Fitness & Bodybuilding Supplement Store | Health PlusHealth Plus is Pakistan's best online store that offers Dietary/Food Supplements, Vitamins, Protein and Bodybuilding Supplement in Pakistan, we have all.
Mobile version
https://healthplus.com.pkPakistan's Best Online Fitness & Bodybuilding Supplement Store | Health PlusHealth Plus is Pakistan's best online store that offers Dietary/Food Supplements, Vitamins, Protein and Bodybuilding Supplement in Pakistan, we have all.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
66protein36contains34supplements32mass31great
Keywords Usage Test
  • Your most common keywords are not appearing in one or more of the meta-tags above. Your primary keywords should appear in your meta-tags to help identify the topic of your webpage to search engines.
Keyword(s) not included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud
absorptionacidsactivealanineaminoanytimeathletesawardblendbrandsbuildcarbohydratescartcellchangecheapestchoicecomparecontainscontentdifferentdigestingeffectiveeliteengageessentialsextrafactorsfastfeaturedfeelfitnessgainergluten-freeglycinegramsgreathealthhelpshigh-qualityhigherimportantincreaseindustryintakesintrainventionjustleanlifestylemakemassmeetmorningmusclemuscletechneedsnightnitronitro-technumbernutritionofferspakistanpluspointspowderspowerfulpre/postproductsproteinproteinsquickratereadreasonsrecoveryreleasedrequiredsalesignificantsimpleslowsourcestorestrongsuperiorsupplementsupplementarysupplementstaurinetechtimeviewvolumewheywinningwishlistworkoutworkouts
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Congratulations! Your webpage contains headings tags.
H1 tags
Home
H2 tags
IMPORTANT REASONS WHY YOU SHOULD BUY MUSCLETECH NITRO TECH SUPPLEMENT
Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! Your website has a sitemap file.
SEO Friendly URL Test
  • Your webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test
  • Your webpage contains "img" tags without the required "alt" atribute.
See full list
Inline CSS Test
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your webpage.
Social Media Check
  • Congratulations! Your website is connected successfully with social media using:
Facebook Google Plus Twitter 
Speed optimizations
Score: 42
Failed: 6
Warnings: 0
Passed: 7
HTML Page Size Test
HTML Compression/GZIP Test
  • Your webpage doesn't use any HTML compression! You should compress your HTML to reduce your page size and page loading times - this will help your site retain visitors and increase page views. If you were using compression, you could be compressing your HTML size by 87% - from 271.33 Kb to 35.94 Kb .
Site Loading Speed Test
  • Your website loading time is around 4.61 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 129
  • 5 HTML Pages
  • 35 CSS Files
  • 59 JS Files
  • 30 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
Image Caching Test
  • Your site is not using cache headers for your images. The cache headers can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
JavaScript Minification Test
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test
  • Some of your website's CSS files are not minified!
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Checker
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 100
Failed: 0
Warnings: 0
Passed: 6
URL Canonicalization Test
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 70
Failed: 2
Warnings: 0
Passed: 4
Microdata Schema Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://healthplus.com.pk/ should be the preferred version of this page. The canonical tag can be useful when there are similar versions of the same content on several URLs (e.g., such as e-commerce sites where URL modifiers like sort parameters are appended to a product page's URL). Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://healthplus.com.pk/" rel="canonical"/>
Nofollow Checker
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
See results list
Disallow Directive Checker
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF records checker
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 +a +mx +a:ns1.es51.siteground.eu include:_spf.mailspamprotection.com ~all

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved