seo site checkup logo
PricingFree ToolsArticles
Log in
Report generated 13 days ago
https://goatmilkstuff.com/collections/goat-milk-soap-classic/products/goat-milk-soap-almond
Your general SEO Checkup Score
Archived
87/100
SEO Score
8 Failed
2 Warnings
48 Passed
Issues to fix
Last found on Nov 25 2021, 04:36 PM
HIGH
The size of your webpage's HTML is 68.38 Kb, and is greater than the average size of 33 Kb. This can lead to slower loading times, lost visitors, and decreased revenue. Good steps to reduce HTML size include: using HTML compression, CSS layouts, external style sheets, and moving javascript to external files.
MEDIUM
Your website is not using cache headers for your JavaScript resources. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site.
MEDIUM
Not all images in this page are properly sized! You are serving images that are larger than needed for the size of the user's viewport.
LOW
Your webpage is using the canonical link tag. This tag specifies that the URL: https://goatmilkstuff.com/products/goat-milk-soap-almond should be the preferred version of this page. The canonical tag can be useful when there are similar versions of the same content on several URLs (e.g., such as e-commerce sites where URL modifiers like sort parameters are appended to a product page's URL). Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
LOW
We've found 3 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
LOW
This webpage has some errors caught by the Chrome DevTools Console!
LOW
Your webpage is using inline CSS styles!
Common SEO issues
3Failed
1Warnings
19Passed
Meta Title Test
  • Congratulations! Your webpage is using a title tag
Almond Goat Milk Soap - Goat Milk Stuff
Meta Description Test
  • Congratulations! Your webpage is using a meta description tag
Goat Milk Soap scented with Almond Essential oil contains fresh goat milk and no harmful chemicals. Great moisturizing soap that smells like cherries!
Google Search Results Preview Test
Almond Goat Milk Soap - Goat Milk Stuffhttps://goatmilkstuff.com/collections/goat-milk-soap-classic/products/goat-milk-soap-almondGoat Milk Soap scented with Almond Essential oil contains fresh goat milk and no harmful chemicals. Great moisturizing soap that smells like cherries!
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
103goat94milk72soap47skin34soaps
Keywords Usage Test
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
acnealmondavailablebabybathbodybuyercardcarecartcollectionscolumncolumnscompaniescompliantcontinuecontrolscostcreatedcreditdebitdescriptiondetailsdirectlyeczemaencryptsessentialexternalfamilyfarmfraudfreegoatgoatshardhelpfulimagesincreaseindustryinformationingredientslaundrylearnlikelinklinksliquidlovemegamenumenusmilknaturaloilsorderpartypaymentpowderprivacyprocessprotectpsoriasisradiationreducereviewreviewsrichrosaceasalesscentsecuresecuritysellsellerssensitivesettingsshareshippingshopsizesizesskinsoapsoapssolidspacerstandardstarstufftransactiontransmissiontraveltypeusedusingvarietyverifiedweeksweightworks
Competitor Domains Test
Understand your competitors' SEO profile

Side-by-side SEO comparisons of up to 5 competitors. See how your SEO can improve against the competition.

Heading Tags Test
  • Congratulations! Your webpage contains headings tags.
H1 tags
Goat Milk SoapAlmond
H2 tags
Currency
Almond Essential Oil Goat Milk Soap Benefits
How to Use Almond Essential Oil Goat Milk Soap
Goat Milk Soap Ingredients and Details
Join the Goat Milk Stuff Family
Robots.txt Test
  • Congratulations! Your site uses a "robots.txt" file.
Sitemap Test
  • Congratulations! Your website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

Image Alt Test
  • Your webpage is using "img" tags with empty or missing "alt" attribute.
See full list
Responsive Image Test
  • Not all images in this page are properly sized! You are serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your webpage.
Console Errors Test
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Social Media Test
  • Congratulations! Your website is connected successfully with social media using:
Facebook Pinterest Twitter 
Need to track more websites?
Get between 3 and 15 monitored websites and supercharge your SEO.
Speed optimizations
3Failed
0Warnings
13Passed
HTML Page Size Test
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using br compression on your code. Your HTML is compressed from 399.66 Kb to 68.38 Kb (83% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 3.41 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Content size by content type
Content type
Percent
Size
javascript
68.0 %
1.52 Mb
image
12.4 %
281.99 Kb
font
9.4 %
215.66 Kb
css
6.1 %
138.65 Kb
html
2.8 %
64.77 Kb
other
1.3 %
29.44 Kb
TOTAL
100%
2.23 Mb
Requests by content type
Content type
Percent
Requests
javascript
36.9 %
58
image
28.7 %
45
other
14.0 %
22
css
7.6 %
12
font
7.6 %
12
html
5.1 %
8
TOTAL
100%
157
Content size by domain
Domain
Percent
Size
cdn.shopify.com
24.9 %
567.58 Kb
googletagmanager.com
10.4 %
236.47 Kb
cdn.reamaze.com
9.6 %
220.24 Kb
h30-deploy.hiconversion.com
8.1 %
185.22 Kb
fonts.shopifycdn.com
6.9 %
157.85 Kb
assets.privy.com
5.9 %
133.92 Kb
connect.facebook.net
4.9 %
113.00 Kb
shopify.privy.com
4.7 %
106.65 Kb
rechargeassets-bootstrapheroes-rechargeapps.netdna-ssl.com
3.7 %
85.02 Kb
tag.getdrip.com
3.4 %
77.46 Kb
Other
17.5 %
399.79 Kb
TOTAL
100%
2.23 Mb
Requests by domain
Domain
Percent
Requests
cdn.shopify.com
32.5 %
51
h30-deploy.hiconversion.com
5.1 %
8
fonts.shopifycdn.com
5.1 %
8
monorail-edge.shopifysvc.com
5.1 %
8
trustspot.io
4.5 %
7
goatmilkstuff.com
3.8 %
6
googletagmanager.com
3.2 %
5
cdn.reamaze.com
3.2 %
5
s3.amazonaws.com
2.5 %
4
google-analytics.com
2.5 %
4
Other
32.5 %
51
TOTAL
100%
157
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test
  • Your webpage is serving all images, javascript and css resources from CDNs.
See results list
Image Caching Test
  • Your webpage is not using uncached images from your domain.
JavaScript Caching Test
  • Your website is not using cache headers for your JavaScript resources. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site.
See results list
CSS Caching Test
  • Your webpage is not using uncached CSS resources from your domain.
JavaScript Minification Test
  • Congratulations! Your website's JavaScript files are minified!
CSS Minification Test
  • Congratulations! Your webpage's CSS resources are minified.
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Track up to 5 competitors 24/7
Analyze SEO metrics & get important information about your competition.
Server and security
1Failed
1Warnings
6Passed
HTTPS Test
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.
  • Security state
    secure
  • Certificate issuer
    R3
  • Valid until
    Jan 05, 2022
Mixed Content Test (HTTP over HTTPS)
  • Congratulations, this webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test
  • This webpage is using the HTTP/2 protocol but not all resources are served over this protocol.
See results list
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • We've found 3 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Monitor your website keywords
Get useful insights and detailed metrics for your most important keywords.
Mobile usability
0Failed
0Warnings
3Passed
Meta Viewport Test
  • This webpage is using a viewport meta tag.
meta name="viewport" content="width=device-width,initial-scale=1"
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Your branded PDF Report is almost ready
Wow your clients with white labeled SEO Reports.
Advanced SEO
1Failed
0Warnings
7Passed
Structured Data Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Custom 404 Error Page Test
  • Congratulations, your website is using a custom 404 error page. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://goatmilkstuff.com/products/goat-milk-soap-almond should be the preferred version of this page. The canonical tag can be useful when there are similar versions of the same content on several URLs (e.g., such as e-commerce sites where URL modifiers like sort parameters are appended to a product page's URL). Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://goatmilkstuff.com/products/goat-milk-soap-almond" rel="canonical"/>
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
Meta Refresh Test
  • Congratulations, this webpage is not using a meta refresh tag.
SPF Records Test
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 include:_spf.google.com ~all
Check your website's SEO for free right now!
seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 14 Day Trial
© SEO Site Checkup 2009-2021 • All rights reserved