seo site checkup logo
PricingFree ToolsArticles
Report generated 2 years ago
https://globedriving.ca
Your general SEO Checkup Score
Archived
97/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 97 out of 100, which is higher than the average score of 75. Our analysis has identified 11 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
11 Failed
4 Warnings
52 Passed
Issues to fix
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
LOW
To protect against spam harvesters, consider hiding or obfuscating email addresses in your page code.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
Common SEO issues
Score: 71
Failed: 3
Warnings: 2
Passed: 14
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 138 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Globe Driving Academy is one of the Best Driving Schools in Toronto, Etobicoke, and North York approved by the Ministry of Transportation
Length: 138 characters
Google Search Results Preview Test
Desktop version
https://globedriving.ca/Globe Driving Academy - Best Driving School Toronto Approved by MTOGlobe Driving Academy is one of the Best Driving Schools in Toronto, Etobicoke, and North York approved by the Ministry of Transportation
Mobile version
https://globedriving.ca/Globe Driving Academy - Best Driving School Toronto Approved by MTOGlobe Driving Academy is one of the Best Driving Schools in Toronto, Etobicoke, and North York approved by the Ministry of Transportation
Social Media Meta Tags Test94% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
en_GB
og:url
https://globedriving.ca/
og:site_name
Globe Driving Academy, Best Driving School Toronto, Etobicoke, North York
og:type
article
og:title
Globe Driving Academy - Best Driving School Toronto Approved by MTO
og:description
Globe Driving Academy is one of the Best Driving Schools in Toronto, Etobicoke, and North York approved by the Ministry of Transportation
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
76driving33online29school28test27toronto
Keywords Usage Test44% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
driving
online
school
test
toronto
Keywords Cloud Test
academyactivitiesapprovedautoawardsbeginnerbestblogbookbookingcancellationcareercentercertificateclairclasscomecontactconversioncoordinatorcoursecoursesdriverdriversdrivingeducationenvelopeetobicokeexaminationfacilitatorfeedbackfinalfreewaysglobeglobedrivinggmailhelphighwayshirehomeinstructorinstructorsinsuranceinternationaljoannajunekalimlearninglessonlessonslicencelicencesmessageministrynaureennearneedneedsnorthofficeonlineontariooutlinepackagepackagesparachutephonepreparationpreviousprocessproctorprofessionalprogramproofquizzesrazarefresherregistrationroadscheduleschoolsendsitestudentstudentssupporttalktechnologytestteststhanktorontotrainingtransportationvehiclevisitvisitingwebsitewrittenyork
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test57% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Affordable In-Car Lessons and Driving Course
H2 tags
Vehicle for Hire Driver Training Program for Drivers...
Driving Lessons G2/G Toronto, Etobicoke, North York
School Car for G2/G Road from Toronto, Etobicoke,...
Beginner Driver Education Program (Online Driving Course)
G1 Licence Knowledge Practice Online Tests
Online Driving Course and Student Tech Support
Driver Ed and Car for Road Test
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Image Alt Test76% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test31% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test68% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Deprecated HTML Tags Test92% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test73% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
Console Errors Test32% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test98% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Speed optimizations
Score: 80
Failed: 4
Warnings: 1
Passed: 14
HTML Page Size Test17% of top 100 sites passed
  • The size of this webpage's HTML is 13.61 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 809 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 76.25 Kb to 13.61 Kb (82% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 3.55 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test78% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
86.7 %
4.08 Mb
font
7.7 %
373.31 Kb
javascript
2.9 %
140.84 Kb
css
2.4 %
116.37 Kb
html
0.3 %
12.28 Kb
other
0.0 %
0 B
TOTAL
100%
4.71 Mb
Requests by content type
Content type
Percent
Requests
image
33.8 %
26
javascript
31.2 %
24
css
23.4 %
18
font
10.4 %
8
html
1.3 %
1
other
0.0 %
0
TOTAL
100%
77
Content size by domain
Domain
Percent
Size
globedriving.ca
96.4 %
4.54 Mb
fonts.gstatic.com
1.9 %
91.09 Kb
maxcdn.bootstrapcdn.com
1.7 %
83.00 Kb
fonts.googleapis.com
0.0 %
1.41 Kb
TOTAL
100%
4.71 Mb
Requests by domain
Domain
Percent
Requests
globedriving.ca
89.6 %
69
fonts.gstatic.com
5.2 %
4
fonts.googleapis.com
2.6 %
2
maxcdn.bootstrapcdn.com
2.6 %
2
TOTAL
100%
77
CDN Usage Test96% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test26% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test69% of top 100 sites passed
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test98% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test14% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.239 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.239 s

0.8 s

1.8 s

First Contentful Paint Test97% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 1.129 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

1.129 s

1.8 s

3 s

Largest Contentful Paint Test92% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 1.53 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

1.53 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img style="-webkit-border-radius: 0px; ..." src="/images/slide/slider_004.jpg#joomlaImage://local-i..." alt="">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.0206. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0206

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Why Students Are Choosing Us Since 2012 our driving school in Toronto turned in...
Html: <div id="t4-other" class="t4-section t4-other">
Score: 0.0204
Server and security
Score: 95
Failed: 1
Warnings: 0
Passed: 6
URL Canonicalization Test96% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "globedriving.ca" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.globedriving.ca
Subject Alternative Names (SANs)
*.globedriving.ca, globedriving.ca
Not valid before
Sun, July 9o 2023, 5:12:22 am (z)
Not valid after
Fri, August 9o 2024, 5:12:21 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
AlphaSSL CA - SHA256 - G4
Intermediate certificate
Common name
AlphaSSL CA - SHA256 - G4
Organization
GlobalSign nv-sa
Location
BE
Not valid before
Wed, October 12o 2022, 3:49:43 am (z)
Not valid after
Tue, October 12o 2027, 12:00:00 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GlobalSign Root CA
Root certificate
Common name
GlobalSign Root CA
Organization
GlobalSign nv-sa
Location
BE
Not valid before
Tue, September 1o 1998, 12:00:00 pm (z)
Not valid after
Fri, January 28o 2028, 12:00:00 pm (z)
Signature algorithm
sha1WithRsaEncryption
Issuer
GlobalSign Root CA
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test95% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test85% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=31536000; includesubdomains; preload
Plaintext Emails Test99% of top 100 sites passed
  • We've found 2 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test90% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1, maximum-scale=1, user-scalable=yes" />
Media Query Responsive Test100% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 98
Failed: 0
Warnings: 1
Passed: 8
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test78% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test100% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test96% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://globedriving.ca/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link class="4SEO_auto_canonical" href="https://globedriving.ca/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test97% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 ip4:184.154.224.15 +a +mx +ip4:184.154.224.7 ?all
Ads.txt Validation Test66% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2026 • All rights reserved