seo site checkup logo
PricingFree ToolsArticles
Report generated 10 years ago
http://foredishop.net
Your general SEO Checkup Score
Archived
100/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 103 out of 100, which is higher than the average score of 75. Our analysis has identified 12 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
12 Failed
0 Warnings
27 Passed
Common SEO issues
Score: 89
Failed: 1
Warnings: 0
Passed: 11
Google Search Results Preview
Desktop version
http://foredishop.net/FOREDI SOLUSI KELUARGA HARMONIS !!! - FOREDiWebsite Resmi FOREDI Herbal Oles Atasi Ejakulasi Dini 5 jam! + Anti Septik Kuat Tahan Lama FOREDI Gel GARANSI 100% ASLI yg direkomendasikan BOYKE, Mitra RESMI Stok TERBARU
Mobile version
http://foredishop.net/FOREDI SOLUSI KELUARGA HARMONIS !!! - FOREDiWebsite Resmi FOREDI Herbal Oles Atasi Ejakulasi Dini 5 jam! + Anti Septik Kuat Tahan Lama FOREDI Gel GARANSI 100% ASLI yg direkomendasikan BOYKE, Mitra RESMI Stok TERBARU
Keywords Cloud
adalahadanyaagarakanalatandaantiantiseptikataubagianbahanbaikbanyakberbedabermanfaatbisabpomcaracepatdalamdapatdarahdaridengandewasadiandiniefekejakulasiereksiforedihangathasilherbalhubunganintimistrijadijamurjanganjikajugakamikarenakemudiankepalakondisilagilalulamalebihluarmakamasihmelakukanmemberikanmembuatmengandungmengurangimenjadimenjagameresapmudahnugrahaobatoleholesoleskanorganorgasmepadapakepasanganpemakaianpembuluhperlupriaprodukramuanrasasachetsajasampaisangatsayasebagaisebelumsebutkansehinggasetelahsudahtahantapiterdaftartiaptidakuntukvitalwaktuyang
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
Image Alt Test
  • Your webpage has 8 'img' tags and all of them has the required 'alt' attribute.
Deprecated HTML Tags
  • We found some HTML deprecated tags. Your are advised to change these old tags with equivalent tags or proper CSS rules.
Google Analytics Test
  • Congratulations! Your website is using the asynchronous version of Google Analytics tracking code.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulation! There is no occurrence of any severe JavaScript Errors in your web page.
Speed optimizations
Score: 42
Failed: 3
Warnings: 0
Passed: 2
HTML Page Size Test
  • Congratulations! Your HTML size is 29.13 Kb and this is under the average web page size of 33 Kb.
    This leads to a faster page loading time than average.
HTML Compression/GZIP Test
  • Your page do not use any HTML compression!
    You should compress your HTML to reduce your page size and page loading times - this will help your site retain visitors and increase page views. If you were using compression, you could be compressing your HTML size by 71 % - from 29.13 Kb to 8.40 Kb which would further reduce your page loading time.
Site Loading Speed Test
  • Your site loading time is around 5.989 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 33
  • 5 HTML Pages
  • 6 CSS Files
  • 7 JS Files
  • 15 Images
  • 0 Flash Files
Image Caching Test
  • Congratulations! Your webpage use 'Expires' header for your images and the browsers will display these images from the cache.
Server and security
Score: 0
Failed: 3
Warnings: 0
Passed: 0
URL Canonicalization Test
HTTPS Test
Plaintext Emails Test
  • We found 1 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 0
Failed: 1
Warnings: 0
Passed: 1
Media Query Responsive Test
  • Your website is not using media queries. You should consider using this technique in order to implement responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 75
Failed: 1
Warnings: 0
Passed: 4
Microdata Schema Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your page does not use the canonical link tag.
Nofollow Checker
  • Your webpage does not use the nofollow meta tag. This means that search engins will crawl all links from your webpage.
Disallow Directive Checker
  • Your robots.txt file is using the disallow directive but it's empty. This means that the whole website can be crawled by search engines.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved