seo site checkup logo
PricingFree ToolsArticles
Report generated 10 days ago
https://fiberzone.net
Your general SEO Checkup Score
Archived
59/100
SEO Score
Your website has received an SEO score of 59 out of 100, which is below the average score of 73. However, there are 23 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
23 Failed
5 Warnings
44 Passed
Issues to fix
HIGH
Enable HTML compression to reduce page size and loading times.
HIGH
H1 and H2 tags ensure better search engine visibility and ranking by providing structure and hierarchy to the content, improving readability, and providing opportunities for keyword optimization.
HIGH
Connect your webpage with social media networks using APIs or AddThis, as social signals are becoming increasingly important for search engines to validate a site's trustworthiness and authority.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Although the initial HTML is loaded securely over HTTPS, some resources are loaded over an insecure HTTP connection. This may cause blocked content or unexpected page behavior.
HIGH
Add descriptive and relevant "alt" attributes to all "img" tags to improve website accessibility.
HIGH
HTTP/2 protocol offers several key improvements, including faster page load times, improved performance, better security and more efficient use of network resources.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
MEDIUM
To enhance website performance, it is recommended to implement a caching mechanism that delivers static HTML content.
MEDIUM
Consider adding cache headers for JavaScript resources to speed up the webpage for returning users.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Consider adding cache headers for images to improve website performance. With cache headers, browsers can cache images and serve them quickly to returning visitors, rather than re-fetching them each time.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
MEDIUM
Consider adding cache headers for CSS resources to speed up the webpage for returning users.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Keep in mind that the NOINDEX meta tag instructs search engines not to index a webpage. Please verify if this is the intended behavior, as the webpage will not appear in search engine results.
LOW
To protect against spam harvesters, consider hiding or obfuscating email addresses in your page code.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 61
Failed: 6
Warnings: 2
Passed: 18
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 16 characters. While there's no target number of characters, titles should be descriptive and concise. Using a title tag with less than 20 characters is a missed opportunity since it can be difficult to fit all your targeted keywords in such a short text.
    We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Home - FiberZone
Length: 16 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Get your fiber connection directly to your property with a whooping hyperfast speed of up to 1000Mbps for home users and up to 10 GB for business users.
Length: 152 characters
Google Search Results Preview Test
Desktop version
https://fiberzone.net/Home - FiberZoneGet your fiber connection directly to your property with a whooping hyperfast speed of up to 1000Mbps for home users and up to 10 GB for business users.
Mobile version
https://fiberzone.net/Home - FiberZoneGet your fiber connection directly to your property with a whooping hyperfast speed of up to 1000Mbps for home users and up to 10 GB for business users.
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
en_US
og:type
website
og:title
Home - FiberZone
og:description
Say hello to your new broadband choice in Hull and its surrounding areas. We are provide access to super-fast fiber optic broadband.
og:url
https://fiberzone.net/
og:site_name
FiberZone
og:updated_time
2023-05-26T08:52:02+00:00
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
17cookies14broadband9help9fiber6home
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
cookies
broadband
help
fiber
home
Keywords Cloud Test
acceptactiveadjustingadvertisementanalyzebandwidthbasedbasicbetterbroadbandbrowserbrowsingbusinesscategorizedcategorycertaincheckchooseclickingcodecollectingconnectionconsentcontactcontentcontractcookiescustomizedealsdetaileddisplayefficientlyenableenablingenglishenhanceessentialexperiencefastfeaturesfiberfreefunctionalfunctionalitiesfunctionsgaminghelphighhomeidentifiableinformationlatencylengthlikelocallostmediamenumonthsnavigatenecessarypackagespacketperformperformancepersonalizedpersonallyplatformspostpreferencesprivacypropertyprovideprovidingreadrejectrequiredroomroutersecureservesharingsitesocialspeedspeedsstorestoredsupporttrafficunderstandunlimitedusedusersvalueviewvisitorswebsitewifizone
Competitor Domains Test
Understand your competitors' SEO profile

Side-by-side SEO comparisons of up to 5 competitors. See how your SEO can improve against the competition.

Heading Tags Test70% of top 100 sites passed
  • This webpage does not contain H1 headings! H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
FAST & RELIABLE SPEED?
No Worries, We've Got You
COVERED!
Explore Fiber Zone Ultrafast Fiber
Great Value For Less
Flexible contract length
Fast gaming experience
Full fiber to your property
Local company with local support
Unlimited Broadband Deals
From
£30
Per Month
Some reasons to choose Fiber Zone broadband
Ultra Fast Gigabit Speed
Stream your full HD or 4K TV channels
Gaming to the limit
ALL SERVICES
QUICK LINKS
REACH US
Robots.txt Test94% of top 100 sites passed
  • Congratulations! Your site uses a "robots.txt" file.
Sitemap Test75% of top 100 sites passed
  • This website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test40% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test38% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test2% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage has some warnings caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test80% of top 100 sites passed
  • This webpage is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Need to track more websites?
Get between 3 and 15 monitored websites and supercharge your SEO.
Speed optimizations
Score: 47
Failed: 10
Warnings: 2
Passed: 11
HTML Page Size Test34% of top 100 sites passed
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 5,159 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage doesn't use HTML compression! We recommend to compress the HTML code in order to reduce the page size and page loading times - this will help a website to retain visitors and increase page views. If the HTML compression will be enabled, the HTML size will be decreased by 85% - from 429.06 Kb to 64.27 Kb .
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 4.85 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
javascript
31.5 %
1.12 Mb
other
26.3 %
953.16 Kb
image
16.3 %
591.21 Kb
css
15.0 %
545.84 Kb
font
6.4 %
231.52 Kb
html
4.5 %
164.46 Kb
TOTAL
100%
3.54 Mb
Requests by content type
Content type
Percent
Requests
javascript
39.3 %
33
css
31.0 %
26
image
16.7 %
14
font
8.3 %
7
other
3.6 %
3
html
1.2 %
1
TOTAL
100%
84
Content size by domain
Domain
Percent
Size
fiberzone.net
86.7 %
3.07 Mb
gstatic.com
4.5 %
163.16 Kb
client.crisp.chat
4.2 %
152.10 Kb
code.jquery.com
2.3 %
83.37 Kb
fonts.gstatic.com
2.2 %
79.71 Kb
fonts.googleapis.com
0.1 %
1.99 Kb
google.com
0.0 %
878 B
TOTAL
100%
3.54 Mb
Requests by domain
Domain
Percent
Requests
fiberzone.net
84.5 %
71
fonts.gstatic.com
6.0 %
5
client.crisp.chat
4.8 %
4
fonts.googleapis.com
1.2 %
1
code.jquery.com
1.2 %
1
google.com
1.2 %
1
gstatic.com
1.2 %
1
TOTAL
100%
84
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • It doesn't appear that this website is caching webpages. Cached pages serve up static html and avoid potentially time consuming queries to your database. It also helps lower server load by up to 80%. Caching most visibly benefits high traffic pages that access a database, but whose content does not change on every page view. Common caching methods include Alternative PHP Cache, Quickcache, and WP Super Cache (for Wordpress sites). Caching mechanisms also typically compress HTML, further reducing page size and load time.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test
  • This webpage is not using images with large metadata.
Image Caching Test99% of top 100 sites passed
See results list
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is not using cache headers for JavaScript resources! Setting cache headers can help to speed up the webpage for returning users.
See results list
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using cache headers for CSS resources! Setting cache headers can help to speed up the webpage for returning users.
See results list
JavaScript Minification Test93% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test97% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 3.65 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.
Largest Contentful Paint element within the viewport:
Text: FAST & RELIABLE SPEED? No Worries, We've Got You COVERED! Check Your Post Code
Html: <section class="elementor-section elementor-top-section elementor-..." data-id="77d5d2c" data-element_type="section" data-settings="{"background_background":"video","background_video...">
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.007. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.
DOM element which contributes the most to CLS score:
Html: <div class="elementor-widget-wrap elementor-element-populated">
Score: 0.0064
Track up to 5 competitors 24/7
Analyze SEO metrics & get important information about your competition.
Server and security
Score: 59
Failed: 5
Warnings: 0
Passed: 5
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "fiberzone.net" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
fiberzone.net
Subject Alternative Names (SANs)
fiberzone.net, mail.fiberzone.net, www.fiberzone.net
Not valid before
Mon, April 10o 2023, 7:00:38 pm (z)
Not valid after
Sun, July 9o 2023, 7:00:37 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R3
Intermediate certificate
Common name
R3
Organization
Let's Encrypt
Location
US
Not valid before
Fri, September 4o 2020, 12:00:00 am (z)
Not valid after
Mon, September 15o 2025, 4:00:00 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage is using mixed content! While the initial HTML is loaded over a secure HTTPS connection, other resources (such as images, videos, stylesheets, scripts) may be loaded over an insecure HTTP connection, which may result in blocked content or unexpected page behavior.
See results list
HTTP2 Test92% of top 100 sites passed
  • This webpage is not using the HTTP/2 protocol!
HSTS Test
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test93% of top 100 sites passed
  • We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Monitor your website keywords
Get useful insights and detailed metrics for your most important keywords.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Your branded PDF Report is almost ready
Wow your clients with white labeled SEO Reports.
Advanced SEO
Score: 87
Failed: 2
Warnings: 1
Passed: 7
Structured Data Test59% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage is using the noindex meta tag! This means that it will be read but not indexed by search engines.
See results list
Canonical Tag Test95% of top 100 sites passed
  • This webpage does not use the canonical link tag.
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 +a +mx +ip4:45.81.36.36 ~all
Ads.txt Validation Test80% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.

Check your website's SEO for free right now!

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2023 • All rights reserved