seo site checkup logo
PricingFree ToolsArticles
Report generated 9 years ago
http://familiechat.dk
Your general SEO Checkup Score
Archived
68/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 68 out of 100, which is below the average score of 75. However, there are 11 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
11 Failed
0 Warnings
28 Passed
Common SEO issues
Score: 60
Failed: 4
Warnings: 0
Passed: 11
Google Search Results Preview Test
Desktop version
http://familiechat.dk/Familie Chat – Gratis chat og Forum – Dansk chatGratis Chat og Forum med venner og familie – Spil og underholdning – video chat – live chat – chat rum – Dansk chat og forum
Mobile version
http://familiechat.dk/Familie Chat – Gratis chat og Forum – Dansk chatGratis Chat og Forum med venner og familie – Spil og underholdning – video chat – live chat – chat rum – Dansk chat og forum
Keywords Cloud Test
activeafbudsrejseraktiveaktivtalenealleapp’sarbejdarbejdskollegerartiklerbarnligesjælebenytbenyttebilkablogbrugebørnchatchatrumdanskdaysdeltagdevelopeddinedisneyellerenglishfamiliefamiliechatfamiliechat.dkfamiliechat familienfantasienfirmaforumgameloftgenkendergennemgodegooglegratisgruppegruppergrænserhelehourshunterhuskindenindholdinviterinviterekingdomskodekonstantkontokøbenhavnlanguagesliveloginlæsmagicmangemedlemmedlemmermembersmeremonthnetværknåroplevelseroplysningeropretplayerprivatprofilprofilerådsammensiderskolensnydekoderspilspillestudiesættertipsunderholdeneungevennerverdenvia mobilvidenvideovippekrusvoresværeweekszftechnologyønsker
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! We've found 1 sitemap file for your website:
SEO Friendly URL Test
  • This analyzed URL is SEO friendly, but internal links on this page contain some links that are not SEO friendly.
See results list
Image Alt Test
  • Your webpage has 30 'img' tags and all of them contain the required 'alt' attribute.
Inline CSS Test
  • Your webpage is using 10 inline CSS styles!
See results list
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Your website does not include a Google Analytics tracker script or this script is not properly installed. You are advised to use Google Analytics and properly install the tracker script in order to get detailed statistics about your website's traffic and traffic sources.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your web page.
Social Media Test
  • Your website is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 65
Failed: 4
Warnings: 0
Passed: 6
HTML Page Size Test
  • Congratulations! Your HTML size is 13.63 Kb and this is under the average web page size of 33 Kb.
    This leads to a faster page loading time than average.
HTML Compression/GZIP Test
  • Congratulations! Your page is successfully compressed using gzip compression on your code.
    Your HTML is compressed from 66.95 Kb to 13.63 Kb (80 % size savings). This helps ensure a faster loading web page and improved user experience.
Site Loading Speed Test
  • Your site loading time is around 10.958 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
Total Objects: 194
  • 8 HTML Pages
  • 14 CSS Files
  • 103 JS Files
  • 68 Images
  • 1 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduce server load.
Flash Test
  • Warning: your website contains flash objects. Flash is an outdated technology that is used to deliver rich multimedia content. Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
See results list
Image Caching Test
  • Your site is not using expires headers for your images. An expires tag can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
Server and security
Score: 0
Failed: 1
Warnings: 0
Passed: 4
URL Canonicalization Test
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
Server: nginx/1.8.1
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 50
Failed: 2
Warnings: 0
Passed: 4
Structured Data Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage is using the canonical link tag. This means that your webpage is not the preferred one to use in the search results.
<link rel="canonical" href="http://familiechat.dk/" />
<link rel='canonical' href='http://familiechat.dk/'>
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engins will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file does not use the disallow directive. This means that the whole website can be crawled by search engines.
SPF Records Test
  • Congratulations! Your DNS server is using an SPF record. This SPF record is listed below:
v=spf1 a mx ptr include:bluehost.com ?all

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved