seo site checkup logo
PricingFree ToolsArticles
Report generated 10 years ago
http://exceleducation.org
Your general SEO Checkup Score
Archived
58/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 58 out of 100, which is below the average score of 75. However, there are 14 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
14 Failed
1 Warnings
23 Passed
Common SEO issues
Score: 61
Failed: 5
Warnings: 0
Passed: 10
Google Search Results Preview Test
Desktop version
http://www.exceleducation.org/HomeCreate an account or log in to Facebook. Connect with friends, family and other people you know. Share photos and videos, send messages and get updates.
Mobile version
http://www.exceleducation.org/HomeCreate an account or log in to Facebook. Connect with friends, family and other people you know. Share photos and videos, send messages and get updates.
Keywords Cloud Test
accountapplicationaspiringaurangabadbatchesbegumcivilcoachingcofoundercompetitiveconceptualconfidencecontactcreatecreate successcriteriad.m.edatadatamapdifferentdirectordownloadse.s.eeligibiltyengineeringengineersenglishentererrorexaminationsexamsexcelexcellenceexcellenceexcelextnfacebookfarazformsfoundergategoal googlegovtguidehandleshomehusaini.e.simprovingindiainfo@exceleducation.orginstitutejobskhanlargerlatestmaharashtramechmechanicalmethodmobilenadeemnagsenvannewspagepanchakkipaperspasswordpeopleprocessproductionprovidespuraquestionr.a.cr.r.brailwaysreachingreadroads.o.msecuritysignstatestructurestudentsstudiesstudysyllabust.o.mteachingtermstextuniversityupdatesviewwords b.e excel started
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! We've found 1 sitemap file for your website:
SEO Friendly URL Test
  • Congratulations! This URL and all internal links on this page are SEO friendly.
Image Alt Test
  • Your webpage has 27 'img' tags and none of them has the required 'alt' attribute.
See full list
Inline CSS Test
  • Your webpage is using 163 inline CSS styles!
See results list
Deprecated HTML Tags Test
  • We found some HTML deprecated tags. Your are advised to change these old tags with equivalent tags or proper CSS rules.
Google Analytics Test
  • Your website does not include Google Analytics tracker script or this script is not properly installed. You are advised to use Google Analytics (and properly install the tracker script) in order to get detailed statistics about your website's traffic and traffic sources.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • We found 12 JavaScript Errors in your web page!
See results list
Social Media Test
  • Congratulations! Your website is connected successfully with social media using: Facebook; AddThis;
Speed optimizations
Score: 53
Failed: 4
Warnings: 1
Passed: 5
HTML Page Size Test
HTML Compression/GZIP Test
  • Congratulations! Your page is successfully compressed using gzip compression on your code.
    Your HTML is compressed from 182.06 Kb to 43.35 Kb (76 % size savings). This helps ensure a faster loading web page and improved user experience.
Site Loading Speed Test
  • Your site loading time is around 18.04 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
Total Objects: 147
  • 20 HTML Pages
  • 8 CSS Files
  • 55 JS Files
  • 64 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • It does not appear that you are caching your pages. Cached pages serve up static html and avoid potentially time consuming queries to your database. It also helps lower server load by up to 80%. Caching most visibly benefits high traffic pages that access a database, but whose content does not change on every page view. Common caching methods include Alternative PHP Cache, Quickcache, and jpcache. Caching mechanisms also typically compress HTML, further reducing page size and load time.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
Image Caching Test
  • Your site is not using expires headers for all of your images. An expires tag can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
Server and security
Score: 0
Failed: 2
Warnings: 0
Passed: 3
URL Canonicalization Test
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
Server: DPS/0.2.2
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • We found 2 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 38
Failed: 2
Warnings: 0
Passed: 3
Structured Data Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage is using the canonical link tag. This means that your webpage is not the preferred one to use in the search results.
<link rel="canonical" href="https://www.facebook.com/" />
Nofollow Tag Test
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved