seo site checkup logo
PricingFree ToolsArticles
Report generated 8 years ago
http://eternalvoice.net
Your general SEO Checkup Score
Archived
63/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 63 out of 100, which is below the average score of 75. However, there are 12 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
12 Failed
0 Warnings
30 Passed
Common SEO issues
Score: 53
Failed: 5
Warnings: 0
Passed: 11
Google Search Results Preview
Desktop version
http://eternalvoice.net/Eternal VoiceEternal Voice (EV) is an organization which runs under the guidance by Param Pujya Swami Nalinanand Giri (SNG) Ji Maharaj. Located at Aananda, 5834 Rolling Drive, Rockville (Derwood) Maryland (MD), Eternal Voice’s primary mission is to spread the message of love, peace and compassion among all through spiritual awareness. Born as Nalin Sood, Param Pujya Swami Nalinanand Giri ji Maharaj, often affectionately addressed as “Swami Ji”, belongs to the lineage of the worshippers of Shri Ram. Swamiji is a spiritual descendant of Param Pujya Swami Satyanand Saraswati ji Maharaj and a follower of his darshan (philosophy) of Ram naam as the source of divine light for humanity. Param Pujya Swami Satyanand Saraswati ji Maharaj is credited as the founder of the spiritual centre of Shree Ram Sharnam (meaning “taking refuge in the name of the Lord”). Thy holiness realized that Ram permeated all souls, all particles and all that is living. Human gurus and all incarnations are subject to the time they are mortal and then they die. It is Ram, the Holy Guru, who is timeless and eternal. Pujya Swami Nalinanand Giri Ji’s spiritual endeavors prospered under the tutelage of Param Pujya Shri Prem Nath Ji Maharaj. It was the He who initiated Swami Nalinanand Giri Ji via Naam Deeksha, and thus became his Guru. Under his tutelage, Pujya Swami Nalinanand Giri Ji attained Brahmacharya (a Hindu religious practice of vow of celibacy and chastity) at a very early age and later adopted Sanyas to become a Sanyaasi (a Hindu monk or priest who renounces all worldly desires and leads a life of begging). Sanyaasi is similar to Priest in the church but the duties of a Sanyaasi are different from those of a hindu pandit Aananda, the ashram or the Guru Ghar as it is fondly called, has become a center for spiritual and religious gatherings in tri state area of Virginia (VA) ,Maryland and Washington state. The satsang hall acts as a sabhagar (auditorium) for sabha (gathering) of not only the Indian religious community but also all other communities in the tri state area.It has a positive energy from all the people meditating and acts as a holi place to many. It also houses a life size idol of Chitchor Banke Bihari Ji (the naughty and child form of Lord Krishna). A wonderful orator and a motivation speaker, Param Pujya Swami Nalinanand Giri Ji Maharaj holds regular sermons and prayer meetings at Ananda on topics – both religious and behavioral- essential for a seeker. Some of the regular areas of discourse that are undertaken by Swami Ji are – Shri Amritwani Ji, Shree Bhakti Prakash Ji, Shrimad Bhagwat Katha, Shri Sunder Kaand Ji Paath, Shri Ramayan Ji, Ideal traits of a seeker etc. Satsangs or hindu gospel conducted by Swami ji revolve around different vedas and puranas in the hindu religion. Additionally, there are Bhajan Sandhyas which center around devotional singing. In such sessions, the entire congregation joins Swami Ji in singing various religions hymns and prayers. Although a Hindu preacher by spiritual lineage, Param Pujya Swami Ji doesn’t limit himself to a Mandir (temple), a Gurudwara or just the Hindu religion. Instead, he is a proponent of harmony and peace across all religions. As a religious preacher, Swami Ji has always identified the good in all religions and preached virtues of faith, devotion, belief, kindness, and worship. He believes that a religious observance of complete dedication, devotion, and spirituality puts a seeker on the path to unison with God. Thy grace is the leading path for all the activities performed.
Mobile version
http://eternalvoice.net/Eternal VoiceEternal Voice (EV) is an organization which runs under the guidance by Param Pujya Swami Nalinanand Giri (SNG) Ji Maharaj. Located at Aananda, 5834 Rolling Drive, Rockville (Derwood) Maryland (MD), Eternal Voice’s primary mission is to spread the message of love, peace and compassion among all through spiritual awareness. Born as Nalin Sood, Param Pujya Swami Nalinanand Giri ji Maharaj, often affectionately addressed as “Swami Ji”, belongs to the lineage of the worshippers of Shri Ram. Swamiji is a spiritual descendant of Param Pujya Swami Satyanand Saraswati ji Maharaj and a follower of his darshan (philosophy) of Ram naam as the source of divine light for humanity. Param Pujya Swami Satyanand Saraswati ji Maharaj is credited as the founder of the spiritual centre of Shree Ram Sharnam (meaning “taking refuge in the name of the Lord”). Thy holiness realized that Ram permeated all souls, all particles and all that is living. Human gurus and all incarnations are subject to the time they are mortal and then they die. It is Ram, the Holy Guru, who is timeless and eternal. Pujya Swami Nalinanand Giri Ji’s spiritual endeavors prospered under the tutelage of Param Pujya Shri Prem Nath Ji Maharaj. It was the He who initiated Swami Nalinanand Giri Ji via Naam Deeksha, and thus became his Guru. Under his tutelage, Pujya Swami Nalinanand Giri Ji attained Brahmacharya (a Hindu religious practice of vow of celibacy and chastity) at a very early age and later adopted Sanyas to become a Sanyaasi (a Hindu monk or priest who renounces all worldly desires and leads a life of begging). Sanyaasi is similar to Priest in the church but the duties of a Sanyaasi are different from those of a hindu pandit Aananda, the ashram or the Guru Ghar as it is fondly called, has become a center for spiritual and religious gatherings in tri state area of Virginia (VA) ,Maryland and Washington state. The satsang hall acts as a sabhagar (auditorium) for sabha (gathering) of not only the Indian religious community but also all other communities in the tri state area.It has a positive energy from all the people meditating and acts as a holi place to many. It also houses a life size idol of Chitchor Banke Bihari Ji (the naughty and child form of Lord Krishna). A wonderful orator and a motivation speaker, Param Pujya Swami Nalinanand Giri Ji Maharaj holds regular sermons and prayer meetings at Ananda on topics – both religious and behavioral- essential for a seeker. Some of the regular areas of discourse that are undertaken by Swami Ji are – Shri Amritwani Ji, Shree Bhakti Prakash Ji, Shrimad Bhagwat Katha, Shri Sunder Kaand Ji Paath, Shri Ramayan Ji, Ideal traits of a seeker etc. Satsangs or hindu gospel conducted by Swami ji revolve around different vedas and puranas in the hindu religion. Additionally, there are Bhajan Sandhyas which center around devotional singing. In such sessions, the entire congregation joins Swami Ji in singing various religions hymns and prayers. Although a Hindu preacher by spiritual lineage, Param Pujya Swami Ji doesn’t limit himself to a Mandir (temple), a Gurudwara or just the Hindu religion. Instead, he is a proponent of harmony and peace across all religions. As a religious preacher, Swami Ji has always identified the good in all religions and preached virtues of faith, devotion, belief, kindness, and worship. He believes that a religious observance of complete dedication, devotion, and spirituality puts a seeker on the path to unison with God. Thy grace is the leading path for all the activities performed.
Keywords Cloud
aanandaabhishekamrerica'samritwaniaudiobhagwatbhajanbhaktibookingsbrahmacharyabrahmanandchalisclassescontactculturaldevidiscoursesdiwaseeydonationsebooksendeavorsenglisheventsexperience'sgalleryganeshgeetgeetageneralgirigopigurbanigyanhawanhindihomeinitiationkaandkathakirtanlineagemahamahapuranamaharajmeditationnaaradnaishtiknalinanandonlinepathpicturepoolprakashpranayamapravachanspremnathprogramspuranaregistrationrudrarulessadhnasaintssandhyasangeetmaysanyaassaraswatisatcharitrasatsangsatsang(vrajsatsangssatyanandscheduleshivshrishrimadspiritualsundarsutraswamiteerthupcomingupnishadvedantavideovishweshwaranandyagyayatrasyoga
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test
  • Congratulations! We've found 1 sitemap file for your website:
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test
  • We have found 7 URLs that are not SEO friendly!
See results list
Image Alt Test
  • Your webpage has 5 'img' tags and 4 of them are missing the required 'alt' attribute.
See full list
Inline CSS Test
  • Your webpage is using 33 inline CSS styles!
See results list
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your web page.
Social Media Check
  • Congratulations! Your website is connected successfully with social media using: Facebook;
Speed optimizations
Score: 80
Failed: 3
Warnings: 0
Passed: 8
HTML Page Size Test
HTML Compression/GZIP Test
  • Congratulations! Your page is successfully compressed using gzip compression on your code.
    Your HTML is compressed from 19.52 Kb to 5.71 Kb (71 % size savings). This helps ensure a faster loading web page and improved user experience.
Site Loading Speed Test
  • Your site loading time is around 1.002 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 22
  • 5 HTML Pages
  • 5 CSS Files
  • 7 JS Files
  • 5 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • It does not appear that you are caching your pages. Cached pages serve up static html and avoid potentially time consuming queries to your database. It also helps lower server load by up to 80%. Caching most visibly benefits high traffic pages that access a database, but whose content does not change on every page view. Common caching methods include Alternative PHP Cache, Quickcache, and jpcache. Caching mechanisms also typically compress HTML, further reducing page size and load time.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
Image Caching Test
  • Your site is not using expires headers for your images. An expires tag can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Checker
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 51
Failed: 3
Warnings: 0
Passed: 3
URL Canonicalization Test
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
Server: Apache/2.4.23
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 80
Failed: 1
Warnings: 0
Passed: 6
Microdata Schema Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your page does not use the canonical link tag.
Nofollow Checker
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Checker
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
SPF records checker
  • Congratulations! Your DNS server is using an SPF record. This SPF record is listed below:
v=spf1 a mx ptr include:secureserver.net ~all
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved