seo site checkup logo
PricingFree ToolsArticles
Report generated 3 years ago
https://equity.guru
Your general SEO Checkup Score
Archived
76/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 76 out of 100, which is higher than the average score of 75. Our analysis has identified 11 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
11 Failed
2 Warnings
47 Passed
Common SEO issues
Score: 62
Failed: 6
Warnings: 1
Passed: 17
Meta Title Test
  • Congratulations! Your webpage is using a title tag
Text: Equity.Guru | Financial Blog | Stock Market Guru
Meta Description Test
  • Congratulations! Your webpage is using a meta description tag
Text: Since 2015, North America’s most reliable smallcap stock market investment information outlet. No punches pulled, no BS accepted, no investor left behind.
Google Search Results Preview Test
Desktop version
https://equity.guruEquity.Guru | Financial Blog | Stock Market GuruSince 2015, North America’s most reliable smallcap stock market investment information outlet. No punches pulled, no BS accepted, no investor left behind.
Mobile version
https://equity.guruEquity.Guru | Financial Blog | Stock Market GuruSince 2015, North America’s most reliable smallcap stock market investment information outlet. No punches pulled, no BS accepted, no investor left behind.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
57december26posted13agriculture10foods9psychedelics
Keywords Usage Test
  • Your most common keywords are not appearing in one or more of the meta-tags above. Your primary keywords should appear in your meta-tags to help identify the topic of your webpage to search engines.
Keyword(s) not included in Title tag
Keyword(s) not included in Meta-Description tag
Keywords Cloud Test
acquireagricultureanalysisbabybasedbillionbiotechbitcoinblackberrycannabischrisclauscompanycontentcornerdecemberdefidollarseasyeditioneducationengenentertainmentequityfeaturedfeaturingfinancefoodsgaalengoldgrandguruhealthhexohomeibogaineideaideasinnovationsinterviewsinvestinvestorjodyketamineloanmarketmarketsmdmameatmilitarymomentmushroomsnasdaqnewsnexenovembernyseotlyoutlookparryplantpodcastspostedpresspsychedelicsquestionsradiorallyredemptionreleaseresourcesroadroundtablesantasciencesectorseriessmallsportsbarspotlightsstockstockstacticstechnicaltechnologiestechnologytheorytodaytooratopictransportunifiedvancevideosvishalwantsweekwellfieldwfldyumy
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your webpage does not contain any H1 headings. H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
Equity.Guru
Investment information for the new generation
Today's Ideas
2022 Technical Outlook: Plant Based Foods
If I had a billion dollars: psychedelics sector edition
2022 Technical Outlook: Psychedelics
A Small Loan of $1 Billion Dollars, Featuring NEXE Innovations Inc. (NEXE.V)
Chris Parry
Featured Stories
More Ideas
News
Follow Us
Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! Your website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test
  • Your webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test
  • Your webpage is using "img" tags with empty or missing "alt" attribute.
See full list
Responsive Image Test
  • Not all images in this page are properly sized! You are serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your webpage.
Console Errors Test
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Social Media Test
  • Congratulations! Your website is connected successfully with social media using:
Facebook Twitter 
Speed optimizations
Score: 87
Failed: 2
Warnings: 1
Passed: 13
HTML Page Size Test
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 352.62 Kb to 43.23 Kb (88% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 2.74 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Content size by content type
Content type
Percent
Size
image
26.6 %
601.05 Kb
javascript
25.0 %
564.54 Kb
other
19.6 %
442.39 Kb
font
13.7 %
308.12 Kb
css
12.3 %
277.46 Kb
html
2.8 %
62.76 Kb
TOTAL
100%
2.20 Mb
Requests by content type
Content type
Percent
Requests
javascript
40.0 %
54
css
27.4 %
37
image
20.7 %
28
font
6.7 %
9
html
3.0 %
4
other
2.2 %
3
TOTAL
100%
135
Content size by domain
Domain
Percent
Size
e4njohordzs.exactdn.com
70.1 %
1.54 Mb
gstatic.com
7.1 %
160.82 Kb
use.fontawesome.com
6.7 %
151.36 Kb
equity.guru
6.4 %
144.18 Kb
googletagmanager.com
4.3 %
97.15 Kb
fonts.gstatic.com
3.4 %
77.40 Kb
google.com
1.0 %
22.18 Kb
google-analytics.com
0.9 %
20.04 Kb
fonts.googleapis.com
0.1 %
1.76 Kb
s.w.org
0.0 %
567 B
TOTAL
100%
2.20 Mb
Requests by domain
Domain
Percent
Requests
e4njohordzs.exactdn.com
73.3 %
99
equity.guru
10.4 %
14
fonts.gstatic.com
3.7 %
5
use.fontawesome.com
3.0 %
4
google.com
3.0 %
4
gstatic.com
2.2 %
3
googletagmanager.com
1.5 %
2
google-analytics.com
1.5 %
2
fonts.googleapis.com
0.7 %
1
s.w.org
0.7 %
1
TOTAL
100%
135
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test
  • Your webpage is not serving all resources (images, javascript and css) from CDNs.
See results list
Image Caching Test
  • Your webpage is not using uncached images from your domain.
JavaScript Caching Test
  • Congratulations! Your website is using cache headers for all JavaScript resources.
CSS Caching Test
  • Congratulations! Your website is using cache headers for all CSS resources.
JavaScript Minification Test
  • Congratulations! Your website's JavaScript files are minified!
See results list
CSS Minification Test
  • Congratulations! Your webpage's CSS resources are minified.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 78
Failed: 2
Warnings: 0
Passed: 6
URL Canonicalization Test
HTTPS Test
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.
Mixed Content Test (HTTP over HTTPS)
  • Congratulations, this webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test
  • This webpage is not using the HTTP/2 protocol!
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • We've found 1 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1, minimum-scale=1" />
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 90
Failed: 1
Warnings: 0
Passed: 8
Structured Data Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Custom 404 Error Page Test
  • Congratulations, your website is using a custom 404 error page. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://equity.guru is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://equity.guru/" rel="canonical"/>
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file does not use the disallow directive. This means that the whole website can be crawled by search engines.
Meta Refresh Test
  • Congratulations, this webpage is not using a meta refresh tag.
SPF Records Test
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 ip4:173.231.203.237 include:_spf.google.com ~all
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved