seo site checkup logo
PricingFree ToolsArticles
Report generated a year ago
https://easebuzz.in
Your general SEO Checkup Score
Archived
88/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 88 out of 100, which is higher than the average score of 75. Our analysis has identified 18 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
18 Failed
3 Warnings
51 Passed
Issues to fix
HIGH
To provide a good user experience, Google recommends that sites should aim for a Largest Contentful Paint duration of 2.5 seconds or less.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
HIGH
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
To provide a good user experience, Google recommends that sites should aim for a First Contentful Paint value of 1.8 seconds or less.
MEDIUM
Reducing the JavaScript execution time can result in faster page load times and a smoother user experience, as it allows the browser to render and display the page more quickly.
MEDIUM
JavaScript errors can impact user experience and may prevent users from viewing the page properly.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
LOW
This website either lacks a favicon or it has not been referenced properly.
Common SEO issues
Score: 82
Failed: 4
Warnings: 1
Passed: 17
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Best Digital Payment solution for Online payment | Easebuzz
Length: 59 characters
Meta Description Test96% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Simplify your online payment processing with Easebuzz. Get access to fast and secure Digital payment solutions for your business. Sign up Now to Schedule a demo!
Length: 161 characters
Google Search Results Preview Test
Desktop version
https://easebuzz.in/Best Digital Payment solution for Online payment | EasebuzzSimplify your online payment processing with Easebuzz. Get access to fast and secure Digital payment solutions for your business. Sign up Now to Schedule a demo!
Mobile version
https://easebuzz.in/Best Digital Payment solution for Online payment | EasebuzzSimplify your online payment processing with Easebuzz. Get access to fast and secure Digital payment solutions for your business. Sign up Now to Schedule a demo!
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:url
https://easebuzz.in/
og:title
Best Digital Payment solution for Online payment | Easebuzz
og:description
Simplify your online payment processing with Easebuzz. Get access to fast and secure Digital payment solutions for your business. Sign up Now to Schedule a demo!
og:image:url
https://ebz-static.s3.ap-south-1.amazonaws.com/easebuzz-static/easebuzz_technology_solutions.png
og:image:secure_url
https://ebz-static.s3.ap-south-1.amazonaws.com/easebuzz-static/easebuzz_technology_solutions.png
og:image:width
1200
og:image:height
630
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
75payments41payment38easebuzz32learn20solution
Keywords Usage Test45% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
payments
payment
easebuzz
learn
solution
Keywords Cloud Test
acceptaccountapisautomatedautomaticallybankingbasedbusinessbusinessescardscollectcollectionconnectedcustomercustomersdashboarddeveloperdigitisedirectdirectlydirectordisbursedocsdropeasebuzzeasilyeasyeasycollecteducationeposexpensefeesfeesbuzzfinancialformformsfreegatewayhaveimmediateimpsinstacollectinstallmentinstantlyintegrateintegrationinvoicingjustlearnlinklinksmanagemanagementmultipleneftofferonboardingonlineoperationsoptionspaymentpaymentspayoutsplansplatformplayplugprepaidprocessproductsrealreconciliationrecurringrtgssaasseamlessservicesignsingleslicessmartsmartbillingsmartxsoftwaresolutionsolutionssplitstoresubscriptionsuitesupporttellerusingvendorvendorsviewvirtualwebstorewirewise
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test59% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Software as a Service embedded with Payments Infrastructure.
H2 tags
Payments
Value Added Service
Financial Service
Full stack technology platform that offers Payment Solutions + SaaS APIs
Accept Payments
Software as a Service
Connected Banking & Payouts
More than 1,50,000 businesses trust Easebuzz payments platform
We are developer centric
Payment solutions tailor-made for varied business needs
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test74% of top 100 sites passed
  • This website has a sitemap file.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test28% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test65% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • This website either doesn't have a favicon or this has not been referenced correctly!
JS Error Test79% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test41% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Speed optimizations
Score: 47
Failed: 10
Warnings: 2
Passed: 8
HTML Page Size Test21% of top 100 sites passed
DOM Size Test54% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 2,932 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 1209.35 Kb to 136.51 Kb (89% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test66% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 24.07 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test71% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in more than 3.5 seconds! When the JavaScript code takes a long time to execute, it slows down the page performance in several ways: longer download times, main thread bottlenecks, delays of "Time To Interactive", memory leaks, etc.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
70.6 %
4.48 Mb
javascript
23.1 %
1.47 Mb
css
3.3 %
211.42 Kb
font
1.3 %
85.49 Kb
other
1.2 %
78.71 Kb
html
0.4 %
27.32 Kb
TOTAL
100%
6.34 Mb
Requests by content type
Content type
Percent
Requests
image
61.8 %
118
javascript
21.5 %
41
css
6.8 %
13
other
6.3 %
12
font
2.6 %
5
html
1.0 %
2
TOTAL
100%
191
Content size by domain
Domain
Percent
Size
easebuzz.in
82.9 %
5.26 Mb
googletagmanager.com
7.4 %
480.09 Kb
smatbot.s3.amazonaws.com
3.8 %
243.96 Kb
cdnjs.cloudflare.com
1.9 %
120.80 Kb
connect.facebook.net
1.4 %
91.59 Kb
fonts.gstatic.com
1.3 %
85.49 Kb
s.adroll.com
0.5 %
32.23 Kb
google-analytics.com
0.3 %
21.51 Kb
snap.licdn.com
0.2 %
14.49 Kb
googleads.g.doubleclick.net
0.1 %
4.61 Kb
Other
0.2 %
13.06 Kb
TOTAL
100%
6.34 Mb
Requests by domain
Domain
Percent
Requests
easebuzz.in
72.3 %
138
cdnjs.cloudflare.com
2.6 %
5
googletagmanager.com
2.6 %
5
fonts.gstatic.com
2.6 %
5
connect.facebook.net
2.1 %
4
facebook.com
2.1 %
4
px.ads.linkedin.com
1.6 %
3
d.adroll.com
1.6 %
3
google-analytics.com
1.0 %
2
googleads.g.doubleclick.net
1.0 %
2
Other
10.5 %
20
TOTAL
100%
191
CDN Usage Test97% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test38% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test97% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test95% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test96% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test10% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test98% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.627 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.627 s

0.8 s

1.8 s

First Contentful Paint Test94% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 16.201 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

16.201 s

1.8 s

3 s

Largest Contentful Paint Test90% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 16.2 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

16.2 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img class="banner-img banner-img-v1 gsap-image" src="/static/base/assets_aug_2021/img/easebuzz/home/Ful..." alt="">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.1108. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.1108

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Products Use Cases Company Pricing Developers Sign In Sign Up Software as a Serv...
Html: <body ng-app="ebzApp" style="" class="loaded">
Score: 0.1042
Server and security
Score: 91
Failed: 1
Warnings: 0
Passed: 6
URL Canonicalization Test97% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "easebuzz.in" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.easebuzz.in
Subject Alternative Names (SANs)
*.easebuzz.in, easebuzz.in
Not valid before
Fri, December 1o 2023, 1:06:35 pm (z)
Not valid after
Wed, January 1o 2025, 1:06:35 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Go Daddy Secure Certificate Authority - G2
Intermediate certificate
Common name
Go Daddy Secure Certificate Authority - G2
Organization
GoDaddy.com, Inc.
Location
Scottsdale, Arizona, US
Not valid before
Tue, May 3o 2011, 7:00:00 am (z)
Not valid after
Sat, May 3o 2031, 7:00:00 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Go Daddy Root Certificate Authority - G2
Root certificate
Common name
Go Daddy Root Certificate Authority - G2
Organization
GoDaddy.com, Inc.
Location
Scottsdale, Arizona, US
Not valid before
Tue, September 1o 2009, 12:00:00 am (z)
Not valid after
Thu, December 31o 2037, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Go Daddy Root Certificate Authority - G2
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test100% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test82% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=7776000; includesubdomains
Plaintext Emails Test100% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test88% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0, maximum-scale=1.0, user-scalable=no" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 65
Failed: 2
Warnings: 0
Passed: 7
Structured Data Test53% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test67% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test98% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://easebuzz.in/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://easebuzz.in/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test95% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 ip4:27.107.3.146 ip4:103.149.113.158 include:_spf.google.com include:spf.mandrillapp.com include:_spf.salesforce.com ~all
Ads.txt Validation Test68% of top 100 sites passed
  • The access to the ads.txt file is restricted! Our request for this resource has returned a {status_code} HTTP status code. In order for this resource to be easily accessed by the DSPs and advertisers, its status code should be 200 OK.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved