seo site checkup logo
PricingFree ToolsArticles
Report generated 7 years ago
http://diva-india.in
Your general SEO Checkup Score
Archived
89/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 89 out of 100, which is higher than the average score of 75. Our analysis has identified 12 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
12 Failed
1 Warnings
24 Passed
Common SEO issues
Score: 82
Failed: 1
Warnings: 1
Passed: 12
Meta Title
  • Congratulations! Your webpage is using a title tag
Text: Indian Tourism India | Travel Guide & Tour Packages | India Travel
Meta Description
  • Congratulations! Your webpage is using a meta description tag
Text: Offering Indian Tours and Travel Information e.g. attractions, sights, rafting, India travel, climate, permits, festivals and maps. Plan trip to India.
Google Search Results Preview
Desktop version
http://diva-india.inIndian Tourism India | Travel Guide & Tour Packages | India TravelOffering Indian Tours and Travel Information e.g. attractions, sights, rafting, India travel, climate, permits, festivals and maps. Plan trip to India.
Mobile version
http://diva-india.inIndian Tourism India | Travel Guide & Tour Packages | India TravelOffering Indian Tours and Travel Information e.g. attractions, sights, rafting, India travel, climate, permits, festivals and maps. Plan trip to India.
Keywords Usage Test
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud
affiliationandamanbhutanbusinesscolourcompanycontactcontributioncopyrightdelhidestinationdestinationsdisclaimerdivadivaindia.comeastexploreextensionfestivalsfleetfloorfollowgoldenhomeindiaindia@divaindia.inindianinformationislesjeeplakshawadeeplankalifelimitedluxurymanagementmarknepalnicobarnoidanorthorangepackagespolicyprivacyprivateprogramesregalregisteredreservedrightsrootssafarisavescrollsectorserviceservicessocialsourcingsouthstretegictempletermsthemestibettigertigerstourtourstradetrailstriangleudaipurunescounitweddingwestwildwildlife
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your webpage does not contain any H1 headings. H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
Robots.txt Test
  • This website is using a robots.txt file.
Image Alt Test
  • Your webpage contains "img" tags without the required "alt" atribute.
See full list
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your webpage.
Speed optimizations
Score: 57
Failed: 3
Warnings: 0
Passed: 3
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 21.12 Kb to 4.67 Kb (78% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 2.65 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 59
  • 1 HTML Pages
  • 9 CSS Files
  • 10 JS Files
  • 39 Images
  • 0 Flash Files
Image Caching Test
  • Your site is not using cache headers for your images. The cache headers can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
CSS Minification Test
  • Some of your website's CSS files are not minified!
See results list
URL Redirects Checker
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 0
Failed: 2
Warnings: 0
Passed: 0
URL Canonicalization Test
Plaintext Emails Test
  • We've found 2 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 1
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Advanced SEO
Score: 30
Failed: 3
Warnings: 0
Passed: 2
Microdata Schema Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your webpage is using the canonical link tag. This tag specifies that the URL: http://www.diva-india.in should be the preferred version of this page. The canonical tag can be useful when there are similar versions of the same content on several URLs (e.g., such as e-commerce sites where URL modifiers like sort parameters are appended to a product page's URL). Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="http://www.diva-india.in" rel="canonical"/>
Disallow Directive Checker
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF records checker
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved