seo site checkup logo
PricingFree ToolsArticles
Report generated 2 years ago
https://dgdshredding.ie
Your general SEO Checkup Score
Archived
74/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 74 out of 100, which is below the average score of 75. However, there are 17 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
17 Failed
3 Warnings
52 Passed
Issues to fix
HIGH
To provide a good user experience, sites should aim for a Largest Contentful Paint duration of 2.5 seconds or less.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
Add descriptive and relevant "alt" attributes to all "img" tags to improve website accessibility.
MEDIUM
To enhance website performance, it is recommended to implement a caching mechanism that delivers static HTML content.
MEDIUM
Consider adding cache headers for JavaScript resources to speed up the webpage for returning users.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Consider adding cache headers for images to improve website performance. With cache headers, browsers can cache images and serve them quickly to returning visitors, rather than re-fetching them each time.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
MEDIUM
Consider adding cache headers for CSS resources to speed up the webpage for returning users.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
To protect against spam harvesters, consider hiding or obfuscating email addresses in your page code.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 84
Failed: 4
Warnings: 0
Passed: 22
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Secure On-Site & Off-Site Shredding Services | DGD Shredding
Length: 60 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Specialists in Paper, Media and Branding destruction. On-Site and Off-Site Shredding services in all 32 counties. Full GDPR compliance. Get a Quote today.
Length: 154 characters
Google Search Results Preview Test
Desktop version
https://dgdshredding.ie/Secure On-Site & Off-Site Shredding Services | DGD ShreddingSpecialists in Paper, Media and Branding destruction. On-Site and Off-Site Shredding services in all 32 counties. Full GDPR compliance. Get a Quote today.
Mobile version
https://dgdshredding.ie/Secure On-Site & Off-Site Shredding Services | DGD ShreddingSpecialists in Paper, Media and Branding destruction. On-Site and Off-Site Shredding services in all 32 counties. Full GDPR compliance. Get a Quote today.
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
en_US
og:type
website
og:title
Secure On-Site & Off-Site Shredding Services | DGD Shredding
og:description
Specialists in Paper, Media and Branding destruction. On-Site and Off-Site Shredding services in all 32 counties. Full GDPR compliance. Get a Quote today.
og:url
https://dgdshredding.ie/
og:site_name
DGD Shredding
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
20shredding10destruction8site6services5contact
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
shredding
destruction
site
services
contact
Keywords Cloud Test
agendaarrivingarrowbiodiversitybusinessclickclientscommitmentcompliancecontactcorkdecreasedemanddestructiondgdshreddingdrivedropdublinefficiencyemailenergyenquiriesenvironmentenvironmentalfacebookfaqsfittedgalwaygdprgreenhardhavehelphighhighlyincreaseindustryinfoinvolvesirelandirishjumpkeyslatestlearnleftlinkedinlocationlocationsmakematerialmediamenumobilenewsoffsiteonsitepagepastphoneplayerpolicyproduceproductproductsqualityquoterangerecyclingregularresourcesrightsalesscheduledsectorssecureserviceservicessettingshredshreddersshreddingsitestandardssustainabilitysustainableteamtestimonialstodaytrainedtransporttwitterunitunitsvideovolumewaterwaterfordyearszoom
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Secure On-site & Off-site Shredding Services Throughout Ireland
H2 tags
Get a Quote today – Call 1800 491 333
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
  • This website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test40% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test38% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Inline CSS Test2% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test80% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook Twitter 
Speed optimizations
Score: 52
Failed: 10
Warnings: 2
Passed: 11
HTML Page Size Test34% of top 100 sites passed
  • The size of this webpage's HTML is 29.49 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 3,412 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 169.46 Kb to 29.49 Kb (83% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 7.76 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
68.0 %
1.85 Mb
javascript
20.0 %
558.65 Kb
font
6.6 %
185.23 Kb
css
3.2 %
89.66 Kb
other
1.5 %
43.09 Kb
html
0.6 %
16.79 Kb
TOTAL
100%
2.72 Mb
Requests by content type
Content type
Percent
Requests
javascript
35.0 %
28
image
30.0 %
24
css
17.5 %
14
font
8.8 %
7
other
7.5 %
6
html
1.3 %
1
TOTAL
100%
80
Content size by domain
Domain
Percent
Size
dgdshredding.ie
77.0 %
2.10 Mb
maps.googleapis.com
10.9 %
303.36 Kb
fonts.gstatic.com
5.6 %
154.98 Kb
googletagmanager.com
5.4 %
150.79 Kb
google-analytics.com
0.7 %
20.59 Kb
snap.licdn.com
0.2 %
4.86 Kb
fonts.googleapis.com
0.1 %
4.18 Kb
maps.gstatic.com
0.0 %
1.39 Kb
google.com
0.0 %
408 B
px.ads.linkedin.com
0.0 %
383 B
Other
0.0 %
1.02 Kb
TOTAL
100%
2.72 Mb
Requests by domain
Domain
Percent
Requests
dgdshredding.ie
47.5 %
38
maps.googleapis.com
20.0 %
16
fonts.gstatic.com
7.5 %
6
fonts.googleapis.com
6.3 %
5
maps.gstatic.com
5.0 %
4
google-analytics.com
3.8 %
3
googletagmanager.com
2.5 %
2
moderate4.cleantalk.org
1.3 %
1
snap.licdn.com
1.3 %
1
cdn.linkedin.oribi.io
1.3 %
1
Other
3.8 %
3
TOTAL
100%
80
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • It doesn't appear that this website is caching webpages. Cached pages serve up static html and avoid potentially time consuming queries to your database. It also helps lower server load by up to 80%. Caching most visibly benefits high traffic pages that access a database, but whose content does not change on every page view. Common caching methods include Alternative PHP Cache, Quickcache, and WP Super Cache (for Wordpress sites). Caching mechanisms also typically compress HTML, further reducing page size and load time.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test99% of top 100 sites passed
See results list
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is not using cache headers for JavaScript resources! Setting cache headers can help to speed up the webpage for returning users.
See results list
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using cache headers for CSS resources! Setting cache headers can help to speed up the webpage for returning users.
See results list
JavaScript Minification Test93% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test97% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is not using render-blocking resources.
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 7.14 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

7.14 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: SECURE ON-SITE & OFF-SITE SHREDDING SERVICES THROUGHOUT IRELAND
Html:

Secure On-site & Off-site
Shredding Services
Throughout Ireland

Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.197. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.

0.1966

0.1

0.25

DOM element which contributes the most to CLS score:
Text: “DGD Shredding – setting the standards in the Irish Shredding Industry for the p...
Html: <div id="after_submenu_3" class="main_color av_default_container_wrap container_wra..." style=" ">
Score: 0.1946
Server and security
Score: 86
Failed: 3
Warnings: 0
Passed: 7
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "dgdshredding.ie" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
www.dgdshredding.ie
Subject Alternative Names (SANs)
www.dgdshredding.ie, dgdshredding.ie
Not valid before
Tue, March 14o 2023, 12:00:00 am (z)
Not valid after
Wed, March 13o 2024, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
RapidSSL Global TLS RSA4096 SHA256 2022 CA1
Intermediate certificate
Common name
RapidSSL Global TLS RSA4096 SHA256 2022 CA1
Organization
DigiCert, Inc.
Location
US
Not valid before
Wed, May 4o 2022, 12:00:00 am (z)
Not valid after
Sun, November 9o 2031, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
DigiCert Global Root CA
Root certificate
Common name
DigiCert Global Root CA
Organization
DigiCert Inc
Location
US
Not valid before
Fri, November 10o 2006, 12:00:00 am (z)
Not valid after
Mon, November 10o 2031, 12:00:00 am (z)
Signature algorithm
sha1WithRsaEncryption
Issuer
DigiCert Global Root CA
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test93% of top 100 sites passed
  • We've found 2 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1, maximum-scale=1" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 98
Failed: 0
Warnings: 1
Passed: 9
Structured Data Test59% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://dgdshredding.ie/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://dgdshredding.ie/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 mx a include:spf.elive.net include:spf.protection.outlook.com -all
Ads.txt Validation Test80% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved