seo site checkup logo
PricingFree ToolsArticles
Report generated 8 years ago
http://demo.easyonline.se
Your general SEO Checkup Score
Archived
60/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 60 out of 100, which is below the average score of 75. However, there are 13 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
13 Failed
2 Warnings
25 Passed
Common SEO issues
Score: 43
Failed: 6
Warnings: 1
Passed: 8
Google Search Results Preview Test
Desktop version
http://demo.easyonline.se/EASYTRYCK.se - Trycksaker på nätetSveriges smidigaste och mest kompletta webbshop för beställning av trycksaker. Välkommen >>
Mobile version
http://demo.easyonline.se/EASYTRYCK.se - Trycksaker på nätetSveriges smidigaste och mest kompletta webbshop för beställning av trycksaker. Välkommen >>
Keywords Cloud Test
absolutallaalltalltidbeachflagbeachflaggabeställabetalarbildredigeringblandblirbästadennadesigndessadinadropflageasyegetelevateellerenkeltexpofinnsflaggaflaggorfleraflestafodradfoldrarfrånfungerarfÖrförföretaggårgörherrhittarhärhöginomintejackankvalitetlangleylitelogologoverktygetlångärmadmarkhammestmycketmÄssbordmässbordnonwovennorquaynärnågotoakvilleobligatorisktolikaottawaplastkortpopuläraportalprisproduktproduktenprodukterprodukternaprofilprodukterreflexerriktigtsamtsettskjortaslazengersmallsnyggsortimentstandardsverigessåldatilltillbehörtillverkadtrycktryckoriginaltröjatröjanusbminnenutanvaravarjevillvisavårvåravårt
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test
  • Your site lacks a sitemap file. Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
SEO Friendly URL Test
  • We have found 64 URLs that are not SEO friendly!
See results list
Image Alt Test
  • Your webpage has 438 'img' tags and 16 of them are missing the required 'alt' attribute.
See full list
Inline CSS Test
  • Your webpage is using 59 inline CSS styles!
See results list
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • We found 8 JavaScript errors on your web page!
See results list
Social Media Test
Speed optimizations
Score: 66
Failed: 3
Warnings: 1
Passed: 7
HTML Page Size Test
HTML Compression/GZIP Test
  • Congratulations! Your page is successfully compressed using gzip compression on your code.
    Your HTML is compressed from 479.63 Kb to 51.52 Kb (89 % size savings). This helps ensure a faster loading web page and improved user experience.
Site Loading Speed Test
  • Your site loading time is around 5.66 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
Total Objects: 133
  • 2 HTML Pages
  • 8 CSS Files
  • 17 JS Files
  • 106 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
Image Caching Test
  • Your site is not using expires headers for all of your images. An expires tag can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 0
Failed: 2
Warnings: 0
Passed: 3
URL Canonicalization Test
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • We found 1 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 50
Failed: 2
Warnings: 0
Passed: 4
Structured Data Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Noindex Tag Test
  • Your webpage use the noindex meta tag. This means that your webpage will be read but not indexed by search engines.
See results list
Canonical Tag Test
  • Your page does not use the canonical link tag.
Nofollow Tag Test
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
Disallow Directive Test
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
SPF Records Test
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved