seo site checkup logo
PricingFree ToolsArticles
Report generated 8 years ago
http://cpi-consulting.eu
Your general SEO Checkup Score
Archived
100/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 111 out of 100, which is higher than the average score of 75. Our analysis has identified 8 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
8 Failed
0 Warnings
32 Passed
Common SEO issues
Score: 84
Failed: 1
Warnings: 0
Passed: 11
Google Search Results Preview Test
Desktop version
http://cpi-consulting.eu/Sales is changing. Are you? | CPI-ConsultingRethinking sales, marketing and customer service. We help you with customer insights, business modelling and lead generation. Get in touch with CPI now!
Mobile version
http://cpi-consulting.eu/Sales is changing. Are you? | CPI-ConsultingRethinking sales, marketing and customer service. We help you with customer insights, business modelling and lead generation. Get in touch with CPI now!
Keywords Cloud Test
admin@cpiconsulting.euadvantageantwerpapproachbeeckestijnbelgiumbenefitblogbookbusinesscatchcentricchangedchangingcheckclientscommercialcommoditisationcompaniescompetitiveconceptscontactcookiecopyrightcreatecustomercustomersdetailsdevelopdifficultiesdisclaimerdisruptivedownloaddrivesefficiencyeindhovenembraceempoweredengagementexperiencefamousflightfollowforumfreegainsgenerategrowhappyholdershomeimprovedincreasedincreasingindustryinsightsinspiredinternetjobs@cpiconsulting.euleadleadersleadsleanlearnleeuwenruilicensemarketmarketingnetherlandsofferingopportunityorganisationaloudepartnering@cpiconsulting.eupolicypreferencepress@cpiconsulting.euprocessqualifiedquestions@cpiconsulting.eureachreallyredefineredesignrethinkingsalessatisfactionsellingselling isservicesimplifysitemapstartsupport@cpiconsulting.eutechnologythingsuniquevlerickwantwhitepaper
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! We've found 2 sitemaps files for your website:
Image Alt Test
  • Your webpage has 10 'img' tags and 8 of them are missing the required 'alt' attribute.
See full list
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your website is using the latest version of Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your web page.
Speed optimizations
Score: 30
Failed: 4
Warnings: 0
Passed: 2
HTML Page Size Test
HTML Compression/GZIP Test
  • Your page do not use any HTML compression!
    You should compress your HTML to reduce your page size and page loading times - this will help your site retain visitors and increase page views. If you were using compression, you could be compressing your HTML size by 75 % - from 63.96 Kb to 16.13 Kb which would further reduce your page loading time.
Site Loading Speed Test
  • Your site loading time is around 4.603 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
Total Objects: 77
  • 8 HTML Pages
  • 17 CSS Files
  • 37 JS Files
  • 15 Images
  • 0 Flash Files
Image Caching Test
  • Your site is not using expires headers for your images. An expires tag can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
URL Redirects Test
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 0
Failed: 1
Warnings: 0
Passed: 1
URL Canonicalization Test
HTTPS Test
Plaintext Emails Test
  • We found 6 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 100
Failed: 0
Warnings: 0
Passed: 6
Structured Data Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your page is using the canonical link tag. This tag specifies that the URL: http://cpi-consulting.eu is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link rel="canonical" href="http://cpi-consulting.eu/" />
Nofollow Tag Test
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file does not use the disallow directive. This means that the whole website can be crawled by search engines.
See results list
SPF Records Test
  • Congratulations! Your DNS server is using an SPF record. This SPF record is listed below:
v=spf1 include:spf.protection.outlook.com -all

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved