seo site checkup logo
PricingFree ToolsArticles
Report generated 3 years ago
https://bellebeauty.co.uk
Your general SEO Checkup Score
Archived
100/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 104 out of 100, which is higher than the average score of 75. Our analysis has identified 12 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
12 Failed
3 Warnings
55 Passed
Issues to fix
HIGH
To provide a good user experience, sites should aim for a Largest Contentful Paint duration of 2.5 seconds or less.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
Using social media meta tags can improve the appearance and content of shared links on social media platforms, potentially increasing click-through rates and engagement with the page.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
To protect against spam harvesters, consider hiding or obfuscating email addresses in your page code.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 84
Failed: 4
Warnings: 0
Passed: 18
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Beauty and Skincare Treatments | Belle Beauty Portsmouth
Length: 56 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Beauty Dermalogica Skincare Specialists. Monthly Offers on Professional Beauty Treatments, Facials, Massage, Tanning, Manicures, CND Shellac, Brows, Lashes, Waxing.
Length: 165 characters
Google Search Results Preview Test
Desktop version
https://www.bellebeauty.co.uk/Beauty and Skincare Treatments | Belle Beauty PortsmouthBeauty Dermalogica Skincare Specialists. Monthly Offers on Professional Beauty Treatments, Facials, Massage, Tanning, Manicures, CND Shellac, Brows, Lashes, Waxing.
Mobile version
https://www.bellebeauty.co.uk/Beauty and Skincare Treatments | Belle Beauty PortsmouthBeauty Dermalogica Skincare Specialists. Monthly Offers on Professional Beauty Treatments, Facials, Massage, Tanning, Manicures, CND Shellac, Brows, Lashes, Waxing.
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is not using social media meta tags! While this type of meta tags don't affect what people see when they visit the webpage, they exist to provide information about it to search engines and social media platforms.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
18beauty15treatments12skin10treatment9online
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
beauty
treatments
skin
treatment
online
Keywords Cloud Test
acidadvancedappearanceappointmentavailablebeautybellebellebeautybodybookbookingcancellationcareclienteleconditionscopnorcosmeticcustomiseddeepdepositdermacodermalogicadetoxextensionseyebroweyelashfacialfacialsfailfemalegifthairhavehomeinfoinjuryinnovativeionactivelatestliftinglistloosemalemanicuremanicuresmassagemicroneedlingnailnailsnanoinfusionnavigationneednewsnosenoticeoffersonlinepedicurepeelpermingpiercingplexigelpolicyportsmouthpowerpowerfulpriceproceduresproductsprofessionalpurchaserangerejuvenatingresultssalonshapingshellacshopskinskincarespecialistssportsstonesswedishtanningtargetedtermstesttexturetherapiestintingtissuetoggletreatmenttreatmentsusesvouchervoucherswaxingwrinkles
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Beauty & Skin Care Specialists. Est. 1997
H2 tags
LATEST BEAUTY OFFERS
BB LATEST NEWS
Nose Piercing Now Available
NEW Dermalogica Advanced Facial Skin Treatments at Belle Beauty
Opening Hours
Gift Vouchers
Useful Links
Contact Us
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
  • This website has a sitemap file.
Image Alt Test71% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test38% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Speed optimizations
Score: 78
Failed: 4
Warnings: 2
Passed: 12
HTML Page Size Test34% of top 100 sites passed
  • The size of this webpage's HTML is 8.33 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,373 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 32.66 Kb to 8.33 Kb (74% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 3.08 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
91.7 %
3.57 Mb
font
3.0 %
119.79 Kb
javascript
2.9 %
115.77 Kb
css
1.7 %
66.24 Kb
html
0.7 %
27.56 Kb
other
0.0 %
164 B
TOTAL
100%
3.89 Mb
Requests by content type
Content type
Percent
Requests
image
52.5 %
31
css
20.3 %
12
javascript
18.6 %
11
html
3.4 %
2
font
3.4 %
2
other
1.7 %
1
TOTAL
100%
59
Content size by domain
Domain
Percent
Size
bellebeauty.co.uk
98.3 %
3.82 Mb
fonts.gstatic.com
1.1 %
44.34 Kb
google-analytics.com
0.5 %
20.07 Kb
credit-card-logos.com
0.1 %
3.33 Kb
fonts.googleapis.com
0.0 %
1.09 Kb
TOTAL
100%
3.89 Mb
Requests by domain
Domain
Percent
Requests
bellebeauty.co.uk
91.5 %
54
google-analytics.com
3.4 %
2
fonts.googleapis.com
1.7 %
1
credit-card-logos.com
1.7 %
1
fonts.gstatic.com
1.7 %
1
TOTAL
100%
59
CDN Usage Test96% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test99% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test93% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test97% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is not using render-blocking resources.
URL Redirects Test96% of top 100 sites passed
  • This URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 4.35 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

4.35 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img src="images/home6a.jpg" class="ls-bg ls-preloaded" alt="Belle Beauty Salon" style="padding: 0px; border-width: 0px; width: 1920px; he...">
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.014. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.

0.0135

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Dermalogica | If we do not have the product you are looking for then purchase ...
Html: <div class="container">
Score: 0.0132
Server and security
Score: 82
Failed: 3
Warnings: 0
Passed: 4
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.bellebeauty.co.uk" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
cpcalendars.bellebeauty.co.uk
Subject Alternative Names (SANs)
bellebeauty.co.uk, cpanel.bellebeauty.co.uk, cpcalendars.bellebeauty.co.uk, cpcontacts.bellebeauty.co.uk, mail.bellebeauty.co.uk, webdisk.bellebeauty.co.uk, webmail.bellebeauty.co.uk, www.bellebeauty.co.uk
Not valid before
Thu, February 2o 2023, 12:24:39 am (z)
Not valid after
Wed, May 3o 2023, 12:24:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R3
Intermediate certificate
Common name
R3
Organization
Let's Encrypt
Location
US
Not valid before
Fri, September 4o 2020, 12:00:00 am (z)
Not valid after
Mon, September 15o 2025, 4:00:00 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Plaintext Emails Test93% of top 100 sites passed
  • We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 98
Failed: 0
Warnings: 1
Passed: 8
Structured Data Test59% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • This webpage does not use the canonical link tag.
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:spf.myukcloud.com -all
Ads.txt Validation Test80% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved