seo site checkup logo
PricingFree ToolsArticles
Report generated 2 years ago
https://baznas.go.id
Your general SEO Checkup Score
Archived
53/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 53 out of 100, which is below the average score of 75. However, there are 24 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
24 Failed
4 Warnings
43 Passed
Issues to fix
HIGH
To provide a good user experience, sites should aim for a Largest Contentful Paint duration of 2.5 seconds or less.
HIGH
It is recommended to avoid URL parameters and to use hyphens to separate words in the URL structure, rather than underscores.
HIGH
To address URL canonicalization issues, it is recommended to select a primary URL for your webpage and set up redirects from all other variations to the preferred one.
HIGH
H1 and H2 tags ensure better search engine visibility and ranking by providing structure and hierarchy to the content, improving readability, and providing opportunities for keyword optimization.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
Consider using structured data in your webpage as it can help search engines gain a better understanding of your content.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
Add descriptive and relevant "alt" attributes to all "img" tags to improve website accessibility.
HIGH
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
Add a sitemap file to help search engine crawlers index content more thoroughly and quickly.
MEDIUM
Add a robots.txt file to properly communicate with web crawlers and prevent unwanted access to sensitive content.
MEDIUM
To enhance website performance, it is recommended to implement a caching mechanism that delivers static HTML content.
MEDIUM
JavaScript errors can impact user experience and may prevent users from viewing the page properly.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
LOW
Replace deprecated HTML tags with their modern equivalents or appropriate CSS rules.
Common SEO issues
Score: 35
Failed: 11
Warnings: 2
Passed: 12
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 6 characters. While there's no target number of characters, titles should be descriptive and concise. Using a title tag with less than 20 characters is a missed opportunity since it can be difficult to fit all your targeted keywords in such a short text.
    We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: BAZNAS
Length: 6 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 267 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Badan Amil Zakat Nasional (BAZNAS) merupakan badan resmi dan satu-satunya yang dibentuk oleh pemerintah berdasarkan Keputusan Presiden RI No. 8 Tahun 2001 yang memiliki tugas dan fungsi menghimpun dan menyalurkan zakat, infaq, dan sedekah (ZIS) pada tingkat nasional.
Length: 267 characters
Google Search Results Preview Test
Desktop version
https://baznas.go.id/BAZNASBadan Amil Zakat Nasional (BAZNAS) merupakan badan resmi dan satu-satunya yang dibentuk oleh pemerintah berdasarkan Keputusan Presiden RI No. 8 Tahun 2001 yang memiliki tugas dan fungsi menghimpun dan menyalurkan zakat, infaq, dan sedekah (ZIS) pada tingkat nasional.
Mobile version
https://baznas.go.id/BAZNASBadan Amil Zakat Nasional (BAZNAS) merupakan badan resmi dan satu-satunya yang dibentuk oleh pemerintah berdasarkan Keputusan Presiden RI No. 8 Tahun 2001 yang memiliki tugas dan fungsi menghimpun dan menyalurkan zakat, infaq, dan sedekah (ZIS) pada tingkat nasional.
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:image
https://baznas.go.id/assets/images/baznas_logo_putih.jpg
og:title
BAZNAS - BADAN AMIL ZAKAT NASIONAL
og:description
Badan Amil Zakat Nasional (BAZNAS) merupakan badan resmi dan satu-satunya yang dibentuk oleh pemerintah berdasarkan Keputusan Presiden RI No. 8 Tahun 2001 yang memiliki tugas dan fungsi menghimpun dan menyalurkan zakat, infaq, dan sedekah (ZIS) pada tingkat nasional.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
35baznas29zakat9informasi8amil8humas
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
baznas
zakat
informasi
amil
humas
Keywords Cloud Test
adminamilanakanaknyaanfaqaarabartinyaautobadanbahasabantubantuanbayarbaznasbeasiswaberartiberasalberitaberkahcendekcendekiadaerahdakwahdaridisapaekonomiformhumasimpianinfakinformasiislamjalinkalijagakalkulatorkatakebencanaankemanusiaankerjakesehatankinikonfirmasilayananlembagaloadluncumaalmemilikimenerimamenggulirkanmenjalinmesirmodalmustahikmuzakinasionalnegerioptimalkanoptimasiorangpascasarjanapedesaanpemasaranpemberianpendidikanpendistribusianperkotaanpermohonanppidprodukprofilprogrampublikregulasirekeningromirumahsamasambutsedekahsekolahselengkapnyasetiapshadaqahsiswasolihinstruktursucisunantahuntentangterkinitingkatkantunasuniversitasusahayangyogyakartazakazakat
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • This webpage does not contain H1 headings! H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
Robots.txt Test94% of top 100 sites passed
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test75% of top 100 sites passed
  • This website lacks a sitemap file! Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
SEO Friendly URL Test40% of top 100 sites passed
  • This webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test38% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Inline CSS Test2% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • We found some HTML deprecated tags! You are advised to change these old tags with equivalent tags or proper CSS rules.
3center
Google Analytics Test69% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test33% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test80% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook Twitter 
Speed optimizations
Score: 59
Failed: 8
Warnings: 1
Passed: 14
HTML Page Size Test34% of top 100 sites passed
  • The size of this webpage's HTML is 16.42 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 2,492 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 118.15 Kb to 16.42 Kb (86% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 12.73 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
73.8 %
3.39 Mb
javascript
18.4 %
865.60 Kb
font
4.0 %
189.24 Kb
css
3.4 %
158.67 Kb
html
0.3 %
16.25 Kb
other
0.0 %
2.05 Kb
TOTAL
100%
4.60 Mb
Requests by content type
Content type
Percent
Requests
image
49.4 %
38
javascript
26.0 %
20
css
10.4 %
8
other
7.8 %
6
font
3.9 %
3
html
2.6 %
2
TOTAL
100%
77
Content size by domain
Domain
Percent
Size
intranet.baznas.go.id
39.7 %
1.82 Mb
simba.baznas.go.id
28.6 %
1.31 Mb
baznas.go.id
16.0 %
752.02 Kb
connect.facebook.net
3.3 %
155.24 Kb
googletagmanager.com
3.3 %
153.22 Kb
s3.amazonaws.com
3.0 %
140.29 Kb
analytics.tiktok.com
2.7 %
124.82 Kb
platform-api.sharethis.com
1.0 %
46.34 Kb
fonts.gstatic.com
0.8 %
37.57 Kb
cdn.livechatinc.com
0.6 %
26.42 Kb
Other
1.2 %
57.73 Kb
TOTAL
100%
4.60 Mb
Requests by domain
Domain
Percent
Requests
baznas.go.id
26.0 %
20
intranet.baznas.go.id
16.9 %
13
cdnjs.cloudflare.com
6.5 %
5
sync.sharethis.com
6.5 %
5
simba.baznas.go.id
5.2 %
4
analytics.tiktok.com
5.2 %
4
t.sharethis.com
3.9 %
3
platform-api.sharethis.com
2.6 %
2
googletagmanager.com
2.6 %
2
lipis.github.io
2.6 %
2
Other
22.1 %
17
TOTAL
100%
77
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • It doesn't appear that this website is caching webpages. Cached pages serve up static html and avoid potentially time consuming queries to your database. It also helps lower server load by up to 80%. Caching most visibly benefits high traffic pages that access a database, but whose content does not change on every page view. Common caching methods include Alternative PHP Cache, Quickcache, and WP Super Cache (for Wordpress sites). Caching mechanisms also typically compress HTML, further reducing page size and load time.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test99% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test93% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test97% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 10.04 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

10.04 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img class="w-100 news-small-size" src="https://baznas.go.id/assets/images/homepage/Web-Ba..." alt="ZAKAT">
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.115. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.

0.115

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Berita Terkini BAZNAS dan UIN Sunan Kalijaga Jalin Kerja Sama Beasiswa Pas ... ...
Html: <div class="col-12 mt-5">
Score: 0.0674
Server and security
Score: 72
Failed: 3
Warnings: 0
Passed: 7
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "baznas.go.id" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
sni.cloudflaressl.com
Organization
Cloudflare, Inc.
Location
San Francisco, California, US
Subject Alternative Names (SANs)
*.baznas.go.id, baznas.go.id, sni.cloudflaressl.com
Not valid before
Mon, February 6o 2023, 12:00:00 am (z)
Not valid after
Tue, February 6o 2024, 11:59:59 pm (z)
Signature algorithm
ecdsaWithSha256
Issuer
Cloudflare Inc ECC CA-3
Intermediate certificate
Common name
Cloudflare Inc ECC CA-3
Organization
Cloudflare, Inc.
Location
US
Not valid before
Mon, January 27o 2020, 12:48:08 pm (z)
Not valid after
Tue, December 31o 2024, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Baltimore CyberTrust Root
Root certificate
Common name
Baltimore CyberTrust Root
Organization
Baltimore
Location
IE
Not valid before
Fri, May 12o 2000, 6:46:00 pm (z)
Not valid after
Mon, May 12o 2025, 11:59:00 pm (z)
Signature algorithm
sha1WithRsaEncryption
Issuer
Baltimore CyberTrust Root
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test93% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 37
Failed: 2
Warnings: 1
Passed: 7
Structured Data Test59% of top 100 sites passed
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • This webpage does not use the canonical link tag.
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:spf.mailtarget.co ?all
Ads.txt Validation Test80% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved