seo site checkup logo
PricingFree ToolsArticles
Report generated 6 hours ago
https://zensum.no
Your general SEO Checkup Score
Archived
83/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 83 out of 100, which is higher than the average score of 75. Our analysis has identified 11 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
11 Failed
5 Warnings
56 Passed
Issues to fix
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
Add a sitemap file to help search engine crawlers index content more thoroughly and quickly.
MEDIUM
JavaScript errors can impact user experience and may prevent users from viewing the page properly.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
To protect against spam harvesters, consider hiding or obfuscating email addresses in your page code.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
This website either lacks a favicon or it has not been referenced properly.
Common SEO issues
Score: 72
Failed: 5
Warnings: 2
Passed: 18
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Refinansier lån og kreditter med Zensum
Length: 39 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: ✓Siden 2013 har vi hjulpet mennesker i Norge og Sverige med å sammenligne lånene sine. ✓Nøye utvalgte långivere for privatlån ✓Gratis og uforpliktende
Length: 150 characters
Google Search Results Preview Test
Desktop version
https://www.zensum.no/Refinansier lån og kreditter med Zensum✓Siden 2013 har vi hjulpet mennesker i Norge og Sverige med å sammenligne lånene sine. ✓Nøye utvalgte långivere for privatlån ✓Gratis og uforpliktende
Mobile version
https://www.zensum.no/Refinansier lån og kreditter med Zensum✓Siden 2013 har vi hjulpet mennesker i Norge og Sverige med å sammenligne lånene sine. ✓Nøye utvalgte långivere for privatlån ✓Gratis og uforpliktende
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:title
Refinansier lån og kreditter med Zensum
og:description
✓Siden 2013 har vi hjulpet mennesker i Norge og Sverige med å sammenligne lånene sine. ✓Nøye utvalgte långivere for privatlån ✓Gratis og uforpliktende
og:image
https://cdn.prod.website-files.com/68346ec0d13e6282cdb1af8c/68594bd9c08d8e6302f8ecdf_Home%20page%20510.png
og:type
website
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
47zensum31informasjonskapsler28formål26tjeneste26navn
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
zensum
informasjonskapsler
formål
tjeneste
navn
Keywords Cloud Test
aktivitetalleanalyseanalyticsbankidbarebedrebestbingboliglånboligverdibrukebrukerbrukernecookiecookieinformationcookiesderesdettedinedissedittellerendreflereforbrukslånformålforståfungererfunksjonellefunksjonergjeldgodtagooglehjelperhjemmesidenhttpshvilkenhvisikkeinformasjoninformasjonskapselinformasjonskapsleneinformasjonskapslerinformationingeninnstillingerkontaktkostnaderkredittkortkundeservicelagresleverandørlångiverlångiveremedlånetakermicrosoftmulignavnnettlesernettsidennettstedetnettstedetsnoenogsåoversiktpartnerpasserpersonligpersonvernpersonvernerklæringpoliciespolicyprivacyrapporteringsformålrefinansieringrenterentenretningslinjersamarbeidersamlersammenlignsikkerhetsitessjekksletteslikspørsmålstatistiskestøttertechnologiesteknisketilbudtilgangtjenestetjenesterutløpstidvåreværezensum
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Flere muligheterFor flere mennesker
H2 tags
Hva er en informasjonskapsel?
Slik bruker nettsiden informasjonskapsler
Hvor lenge lagres informasjonskapsler?
Avvise eller slette informasjonskapsler
Hvordan kan jeg slette informasjonskapsler?
Endre ditt samtykke
Har du spørsmål?
Hva sier kundene våre?
Slik fungerer det hos Zensum
Zensum hjelper deg
Vanlige spørsmål
Sammenlign lån, refinansier og få bedre økonomisk oversikt – med Zensum
Andre har sett på
Populære artikler
Dette er Zensum
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
  • This website lacks a sitemap file! Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
SEO Friendly URL Test29% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test78% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test29% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test10% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • This website either doesn't have a favicon or this has not been referenced correctly!
JS Error Test83% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test27% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
meta charset="utf-8"
Social Media Test75% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook 
Speed optimizations
Score: 91
Failed: 2
Warnings: 2
Passed: 21
HTML Page Size Test23% of top 100 sites passed
  • The size of this webpage's HTML is 27.68 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,380 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 178.1 Kb to 27.68 Kb (84% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 3.28 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
javascript
79.0 %
788.97 Kb
other
5.3 %
53.38 Kb
font
5.2 %
51.50 Kb
image
4.8 %
48.40 Kb
css
3.2 %
31.90 Kb
html
2.5 %
24.52 Kb
TOTAL
100%
998.66 Kb
Requests by content type
Content type
Percent
Requests
javascript
40.9 %
27
image
31.8 %
21
other
13.6 %
9
css
6.1 %
4
html
4.5 %
3
font
3.0 %
2
TOTAL
100%
66
Content size by domain
Domain
Percent
Size
online-forms.zensum.se
39.6 %
395.08 Kb
cdn.prod.website-files.com
18.4 %
183.27 Kb
googletagmanager.com
12.6 %
125.64 Kb
widget.trustpilot.com
9.0 %
90.36 Kb
fonts.gstatic.com
5.2 %
51.50 Kb
cdn.jsdelivr.net
4.9 %
48.83 Kb
policy.app.cookieinformation.com
3.7 %
36.90 Kb
d3e54v103j8qbb.cloudfront.net
3.0 %
29.87 Kb
zensum.no
1.7 %
17.17 Kb
api.locize.app
0.8 %
8.44 Kb
Other
1.2 %
11.60 Kb
TOTAL
100%
998.66 Kb
Requests by domain
Domain
Percent
Requests
cdn.prod.website-files.com
59.1 %
39
widget.trustpilot.com
13.6 %
9
policy.app.cookieinformation.com
6.1 %
4
cdn.jsdelivr.net
3.0 %
2
fonts.gstatic.com
3.0 %
2
zensum.no
1.5 %
1
ajax.googleapis.com
1.5 %
1
d3e54v103j8qbb.cloudfront.net
1.5 %
1
new.website.zensum.se
1.5 %
1
online-forms.zensum.se
1.5 %
1
Other
7.6 %
5
TOTAL
100%
66
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test95% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test95% of top 100 sites passed
  • This webpage is not using uncached images from same domain.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is not using uncached JavaScript resources from same domain!
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test100% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test97% of top 100 sites passed
  • This URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.056 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.056 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 2.397 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

2.397 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 0.52 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

0.52 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img src="https://cdn.prod.website-files.com/68346ec0d13e628..." alt="Zensum Norge" data-w-id="070c1d5d-0797-0949-fed8-a2b1398d13b2" class="section_hero-img" style="transform: translate3d(0px, 200px, 0px) scale3d(1,...">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0029. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0029

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Flere muligheter For flere mennesker Når banken sier nei, gir vi deg nye valg Tj...
Html: <div class="section_hero-content">
Score: 0.0029
Server and security
Score: 90
Failed: 2
Warnings: 0
Passed: 8
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.zensum.no" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
www.zensum.no
Subject Alternative Names (SANs)
www.zensum.no
Not valid before
Mon, July 14o 2025, 2:24:34 am (z)
Not valid after
Sun, October 12o 2025, 3:24:33 am (z)
Signature algorithm
ecdsaWithSha256
Issuer
WE1
Intermediate certificate
Common name
WE1
Organization
Google Trust Services
Location
US
Not valid before
Wed, December 13o 2023, 9:00:00 am (z)
Not valid after
Tue, February 20o 2029, 2:00:00 pm (z)
Signature algorithm
ecdsaWithSha384
Issuer
GTS Root R4
Root certificate
Common name
GTS Root R4
Organization
Google Trust Services LLC
Location
US
Not valid before
Wed, June 22o 2016, 12:00:00 am (z)
Not valid after
Sun, June 22o 2036, 12:00:00 am (z)
Signature algorithm
ecdsaWithSha384
Issuer
GTS Root R4
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=31536000
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test95% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test97% of top 100 sites passed
  • We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 67
Failed: 2
Warnings: 1
Passed: 6
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.zensum.no/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.zensum.no" rel="canonical"/>
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • The robots.txt file does not use the disallow directive. This means that the whole website can be crawled by search engines.
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:spf.mandrillapp.com include:_spf.google.com ~all
Ads.txt Validation Test67% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved