seo site checkup logo
PricingFree ToolsArticles
Report generated 6 years ago
https://www.zgallerie.com
Your general SEO Checkup Score
Archived
62/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 62 out of 100, which is below the average score of 75. However, there are 13 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
13 Failed
5 Warnings
33 Passed
Common SEO issues
Score: 77
Failed: 3
Warnings: 2
Passed: 16
Meta Title Test
  • Congratulations! Your webpage is using a title tag
Text: Home Décor Store | Affordable & Modern Furniture | Z Gallerie
Meta Description Test
  • Congratulations! Your webpage is using a meta description tag
Text: Shop affordable home décor & stylish, chic furniture at Z Gallerie. Browse our collection of modern furniture, bedding, art & more or visit us in store!
Google Search Results Preview Test
Desktop version
https://www.zgallerie.comHome Décor Store | Affordable & Modern Furniture | Z GallerieShop affordable home décor & stylish, chic furniture at Z Gallerie. Browse our collection of modern furniture, bedding, art & more or visit us in store!
Mobile version
https://www.zgallerie.comHome Décor Store | Affordable & Modern Furniture | Z GallerieShop affordable home décor & stylish, chic furniture at Z Gallerie. Browse our collection of modern furniture, bedding, art & more or visit us in store!
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
33shop20furniture18room15rugs15outdoor
Keywords Usage Test
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
accessoriesaliciaallowapartmentaprilbathbeddingbedroombedsbenchesbottlesboxesbrowsercabinetscaliforniacardscartcartscatalogcategorychairschestsclockscollectioncolorcontinuecookiescurrentlycustomcustomerdecordiningentrywayfashionfeaturedfloorframesfurnituregalleriegallerygamegiftgiftsguidehomeinspirationitemslampslightinglimitedlivinglookbookmakemirroredmirrorsmultiplenaturalofficeonlineorderottomansoutdoorperfectperfumephotopillowsreservationsroomroomsrugssalescaleshippingshopshoppingsignsizessmallsofasspacespacesspringstoolsstoragestoresstylesummertabletablestabletopthankthrowstimetipstracktypevasesviewvisitwall
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your page contains too many H1 tags. H1 tags should re-inforce the intended topic of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 5 H1 tags.
H1 tags
Spring Clearance up to 50% off
Up to 30% off Furniture
Up to 30% Bedding
25% off Perfume Bottles
30% off Clocks
Introducing Spring / Summer 2019
Alicia's Bedroom Makeover
Instant Chic
Botanical Vibes
Make it 100% You
Meet Jen
Meet Maddox
Need it now?
#ZGallerieMoment
Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! Your website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test
  • Your webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test
  • Your webpage is using "img" tags with empty or missing "alt" attribute.
See full list
Inline CSS Test
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test
  • We found some HTML deprecated tags. You are advised to change these old tags with equivalent tags or proper CSS rules.
1font1u
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your webpage.
Social Media Test
  • Congratulations! Your website is connected successfully with social media using:
Facebook Pinterest Twitter 
Speed optimizations
Score: 39
Failed: 7
Warnings: 2
Passed: 7
HTML Page Size Test
HTML Compression/GZIP Test
  • Your webpage doesn't use any HTML compression! You should compress your HTML to reduce your page size and page loading times - this will help your site retain visitors and increase page views. If you were using compression, you could be compressing your HTML size by 77% - from 142.48 Kb to 32.46 Kb .
Site Loading Speed Test
  • Your website loading time is around 5.19 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
Total Objects: 144
  • 3 HTML Pages
  • 10 CSS Files
  • 53 JS Files
  • 78 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test
  • Your webpage is not serving all resources (images, javascript and css) from CDNs.
See results list
Image Caching Test
  • Congratulations! Your website is using cache headers for your images and the browsers will display these images from the cache.
JavaScript Caching Test
  • Congratulations! Your website is using cache headers for all JavaScript resources.
CSS Caching Test
  • Congratulations! Your website is using cache headers for all CSS resources.
JavaScript Minification Test
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test
  • Some of your webpage's CSS resources are not minified.
See results list
Nested Tables Test
  • It appears that your site contains nested tables. Nested tables can be slow to render in some browsers. Consider using a CSS layout to reduce both HTML size and page loading time.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd">
URL Redirects Test
  • Your URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Server and security
Score: 57
Failed: 2
Warnings: 1
Passed: 3
URL Canonicalization Test
HTTPS Test
  • Your website is successfully using the HTTPS protocol, but the SSL Certificate will expire in less than a month! Having an up-to-date certificate is an important security practice to ensure that your website is safe and provides trust, and any communication between the user's browser and your website (such as passwords, credit cards, or forms) is encrypted and private.
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
Server: Microsoft-IIS/7.5
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 75
Failed: 1
Warnings: 0
Passed: 5
Structured Data Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage does not use the canonical link tag.
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved