seo site checkup logo
PricingFree ToolsArticles
Report generated 7 years ago
https://www.yorkbodycasting.co.uk
Your general SEO Checkup Score
Archived
67/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 67 out of 100, which is below the average score of 75. However, there are 11 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
11 Failed
1 Warnings
37 Passed
Common SEO issues
Score: 60
Failed: 6
Warnings: 0
Passed: 15
Meta Title Test
  • Congratulations! Your webpage is using a title tag
Text: York Body Casting, Life Casting & Sculptures , Celebrating the human form as a Work of Art,
Meta Description Test
  • Congratulations! Your webpage is using a meta description tag
Text: Here at York Body Casting we can sculpt almost anything, pregnancy casts, full torso casts, breast casts, lips , noses, hands, feet, breasts & nipples. Mounted & framed Casts also available.
Google Search Results Preview Test
Desktop version
https://www.yorkbodycasting.co.ukYork Body Casting, Life Casting & Sculptures , Celebrating the human form as a Work of Art,Here at York Body Casting we can sculpt almost anything, pregnancy casts, full torso casts, breast casts, lips , noses, hands, feet, breasts & nipples. Mounted & framed Casts also available.
Mobile version
https://www.yorkbodycasting.co.ukYork Body Casting, Life Casting & Sculptures , Celebrating the human form as a Work of Art,Here at York Body Casting we can sculpt almost anything, pregnancy casts, full torso casts, breast casts, lips , noses, hands, feet, breasts & nipples. Mounted & framed Casts also available.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
7casts5events4cast4studio3adult
Keywords Usage Test
  • Your most common keywords are not appearing in one or more of the meta-tags above. Your primary keywords should appear in your meta-tags to help identify the topic of your webpage to search engines.
Keyword(s) not included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
adultairbrushedappointmentareaattendavailablebabiesbabybodybookbuiltbumpscastcastingcastingscastscategoriescherishcherishedchildrenchildrenscleancomfortablecommissioncontactdecorateddeliverydetailedeventeventsfacebookfinishesforeverforwardframeframedgifthandclasphighlyhomeimportantlyinformationinstagramjourneykitslifelocallocatedlookmaybemeetingmemorymodernmountnaughtyofficepaintparentsperfectpostpostspregnancypricesprivacyrecentregularlyrelaxedremembersaleschedulesculpturesculpturessiblingspecialstudiotinytoddlertoestwitteruncategorisedunicornfartsupcomingviewwantworkworksyorkyorkbodycasting.co.uk
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your webpage does not contain any H1 headings. H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
Pregnancy Casts
Adult Castings
Works of Art
Highly Detailed
Cherished Children
Special Delivery
Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! Your website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test
  • Congratulations! All links from your webpage are SEO friendly.
Image Alt Test
  • Your webpage contains "img" tags without the required "alt" atribute.
See full list
Inline CSS Test
  • Congratulations! Your webpage does not use inline CSS styles.
Deprecated HTML Tags Test
  • We found some HTML deprecated tags. You are advised to change these old tags with equivalent tags or proper CSS rules.
1font
Google Analytics Test
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your webpage.
Social Media Test
  • Your website is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 72
Failed: 2
Warnings: 1
Passed: 10
HTML Page Size Test
  • Congratulations! The size of your webpage's HTML is 4.58 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 16.15 Kb to 4.58 Kb (72% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 3.2 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
  • Congratulations, your page has fewer than 20 http requests. A higher number of http requests results in a user's browser needing to request a large number of objects from your server, which will ultimately slow down the loading of your web page.
Total Objects: 17
  • 1 HTML Pages
  • 2 CSS Files
  • 5 JS Files
  • 9 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
Image Caching Test
  • Congratulations! Your webpage is using cache headers for your images and the browsers will display these images from the cache.
JavaScript Minification Test
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test
  • Some of your website's CSS files are not minified!
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Strict//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-strict.dtd">
URL Redirects Test
  • Your URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Server and security
Score: 77
Failed: 1
Warnings: 0
Passed: 5
URL Canonicalization Test
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 0
Failed: 1
Warnings: 0
Passed: 1
Media Query Responsive Test
  • Your website is not using media queries. You should consider using this technique in order to implement responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 80
Failed: 1
Warnings: 0
Passed: 6
Structured Data Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage does not use the canonical link tag.
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file does not use the disallow directive. This means that the whole website can be crawled by search engines.
SPF Records Test
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 +a +mx +ip4:94.229.76.104 ~all
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved