seo site checkup logo
PricingFree ToolsArticles
Report generated 10 days ago
https://www.worldometers.info/geography/countries-of-the-world
Your general SEO Checkup Score
Archived
67/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 67 out of 100, which is below the average score of 75. However, there are 18 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
18 Failed
4 Warnings
52 Passed
Issues to fix
HIGH
To address URL canonicalization issues, it is recommended to select a primary URL for your webpage and set up redirects from all other variations to the preferred one.
HIGH
Add a meta description tag to provide a brief and informative summary of the page's content for search engines.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
Consider using structured data in your webpage as it can help search engines gain a better understanding of your content.
HIGH
Connect your webpage with social media networks using APIs or AddThis, as social signals are becoming increasingly important for search engines to validate a site's trustworthiness and authority.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
Add descriptive and relevant "alt" attributes to all "img" tags to improve website accessibility.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
MEDIUM
Add a robots.txt file to properly communicate with web crawlers and prevent unwanted access to sensitive content.
MEDIUM
Reducing the JavaScript execution time can result in faster page load times and a smoother user experience, as it allows the browser to render and display the page more quickly.
MEDIUM
JavaScript errors can impact user experience and may prevent users from viewing the page properly.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 57
Failed: 8
Warnings: 0
Passed: 18
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Countries of the World by Population - Worldometer
Length: 50 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is not using a meta description tag! You should include this tag in order to provide a brief description of your page which can be used by search engines. Well-written and inviting meta descriptions may also help click-through rates to your site in search engine results.
Google Search Results Preview Test
Desktop version
https://www.worldometers.info/geography/countries-of-the-world/Countries of the World by Population - Worldometer
Mobile version
https://www.worldometers.info/geography/countries-of-the-world/Countries of the World by Population - Worldometer
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
en
og:type
website
og:url
http://www.worldometers.info/geography/countries-of-the-world/
og:site_name
Worldometer
og:title
Countries of the World by Population - Worldometer
og:image
https://www.worldometers.info/img/worldometers-fb.jpg
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
55africa48asia44europe35america33latin
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
africa
asia
europe
america
latin
Keywords Cloud Test
afghanistanafricaagriculturealgeriaalphabeticalamericaangolaarabiaargentinaasiabangladeshbrazilcamerooncanadachinaclassificationcolombiacongocoronaviruscountedcountriescountrycôtedefinitiondenmarkdependenciesdividedegyptemissionsenergyethiopiaeuropeflagsfollowingfoodfrancefrenchgermanyghanagroupsguineahaveincludesindiaindonesiairaniraqislandsitalyivoirejapankenyakingdomkorealargestlatinlistmadagascarmalaysiamexicomoroccomozambiquemyanmarnepalnetherlandsnigerianorthnorthernoceaniapakistanpartlyperuphilippinespolandpopulationrankedregionrepublicrussiasaintsamoasaudisouthspainstatessudantanzaniaterritoriesthailandturkeyugandaukraineuniteduzbekistanvietnamvirginwaterworldyemenzealand
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Countries of the World
H2 tags
Dependencies or other territories
Robots.txt Test99% of top 100 sites passed
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test83% of top 100 sites passed
  • This website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test29% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test78% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test29% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test10% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test27% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Social Media Test75% of top 100 sites passed
  • This webpage is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 69
Failed: 7
Warnings: 2
Passed: 16
HTML Page Size Test23% of top 100 sites passed
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,952 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 295.12 Kb to 38.16 Kb (87% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 6.28 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in more than 3.5 seconds! When the JavaScript code takes a long time to execute, it slows down the page performance in several ways: longer download times, main thread bottlenecks, delays of "Time To Interactive", memory leaks, etc.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
html
60.6 %
5.78 Mb
javascript
30.2 %
2.88 Mb
other
5.7 %
556.71 Kb
image
2.2 %
210.44 Kb
font
1.1 %
104.87 Kb
css
0.3 %
29.20 Kb
TOTAL
100%
9.54 Mb
Requests by content type
Content type
Percent
Requests
html
33.8 %
452
image
30.2 %
404
other
28.8 %
385
javascript
6.4 %
86
css
0.6 %
8
font
0.2 %
3
TOTAL
100%
1338
Content size by domain
Domain
Percent
Size
worldometers.info
50.0 %
4.77 Mb
live.primis.tech
9.1 %
889.13 Kb
pagead2.googlesyndication.com
6.3 %
619.45 Kb
securepubads.g.doubleclick.net
5.8 %
566.86 Kb
imasdk.googleapis.com
4.1 %
404.96 Kb
googletagmanager.com
3.5 %
340.41 Kb
a.pub.network
3.4 %
335.87 Kb
cdn.confiant-integrations.net
1.5 %
148.70 Kb
googleads.g.doubleclick.net
1.5 %
147.82 Kb
ads.pubmatic.com
1.3 %
122.74 Kb
Other
13.4 %
1.28 Mb
TOTAL
100%
9.54 Mb
Requests by domain
Domain
Percent
Requests
worldometers.info
20.3 %
271
cm.g.doubleclick.net
5.3 %
71
s.amazon-adsystem.com
3.5 %
47
sync.inmobi.com
3.5 %
47
pagead2.googlesyndication.com
2.4 %
32
us-u.openx.net
2.1 %
28
usersync.gumgum.com
2.0 %
27
btlr.sharethrough.com
1.9 %
25
ce.lijit.com
1.6 %
21
securepubads.g.doubleclick.net
1.4 %
19
Other
56.1 %
750
TOTAL
100%
1338
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test95% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test95% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test100% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test97% of top 100 sites passed
  • This URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.078 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.078 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 0.738 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

0.738 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 0.92 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

0.92 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: Countries (following the U.N. definition and classification, for which we have c...
Html:
  • Countries (following the U.N. definition and classification, for which we have counted
  • 0.1968

    0.1

    0.25

    DOM element which contributes the most to CLS score:
    Text: Population More W / Population / Countries of the World (ranked by population)...
    Html: <div class="flex flex-col">
    Score: 0.0833
    Server and security
    Score: 72
    Failed: 2
    Warnings: 1
    Passed: 7
    URL Canonicalization Test93% of top 100 sites passed
    SSL Checker and HTTPS Test100% of top 100 sites passed
    • This website is successfully using HTTPS, a secure communication protocol over the Internet.

    The certificate is not used before the activation date.

    The certificate has not expired.

    The hostname "www.worldometers.info" is correctly listed in the certificate.

    The certificate should be trusted by all major web browsers.

    The certificate was not revoked.

    The certificate was signed with a secure hash.

    Certificate Chain:
    Server certificate
    Common name
    www.worldometers.info
    Subject Alternative Names (SANs)
    www.worldometers.info
    Not valid before
    Fri, March 21o 2025, 10:07:59 pm (z)
    Not valid after
    Thu, June 19o 2025, 11:07:57 pm (z)
    Signature algorithm
    ecdsaWithSha256
    Issuer
    WE1
    Intermediate certificate
    Common name
    WE1
    Organization
    Google Trust Services
    Location
    US
    Not valid before
    Wed, December 13o 2023, 9:00:00 am (z)
    Not valid after
    Tue, February 20o 2029, 2:00:00 pm (z)
    Signature algorithm
    ecdsaWithSha384
    Issuer
    GTS Root R4
    Root certificate
    Common name
    GTS Root R4
    Organization
    Google Trust Services LLC
    Location
    US
    Not valid before
    Wed, June 22o 2016, 12:00:00 am (z)
    Not valid after
    Sun, June 22o 2036, 12:00:00 am (z)
    Signature algorithm
    ecdsaWithSha384
    Issuer
    GTS Root R4
    Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
    • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
    HTTP2 Test99% of top 100 sites passed
    • This webpage is using the HTTP/2 protocol but not all resources are served over this protocol!
    See results list
    HSTS Test84% of top 100 sites passed
    • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
    Safe Browsing Test100% of top 100 sites passed
    • This website is not currently listed as suspicious (no malware or phishing activity found).
    Server Signature Test95% of top 100 sites passed
    • The server signature is off for this webpage.
    Directory Browsing Test100% of top 100 sites passed
    • Directory browsing is disabled for this website.
    Plaintext Emails Test97% of top 100 sites passed
    • This webpage does not include email addresses in plaintext.
    Mobile usability
    Score: 100
    Failed: 0
    Warnings: 0
    Passed: 3
    Meta Viewport Test92% of top 100 sites passed
    • This webpage is using a viewport meta tag.
    <meta name="viewport" content="width=device-width, initial-scale=1" />
    Media Query Responsive Test98% of top 100 sites passed
    • This webpage is using CSS media queries, which is the base for responsive design functionalities.
    Mobile Snapshot Test
    Mobile view
    Advanced SEO
    Score: 67
    Failed: 1
    Warnings: 1
    Passed: 8
    Structured Data Test66% of top 100 sites passed
    Custom 404 Error Page Test80% of top 100 sites passed
    • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
    Noindex Tag Test99% of top 100 sites passed
    • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
    Canonical Tag Test93% of top 100 sites passed
    • This webpage does not use the canonical link tag.
    Nofollow Tag Test
    • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
    Disallow Directive Test
    • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
    Meta Refresh Test98% of top 100 sites passed
    • This webpage is not using a meta refresh tag.
    SPF Records Test94% of top 100 sites passed
    • This DNS server is using an SPF record.
    v=spf1 +a +mx +ip4:170.249.202.146 +ip4:170.249.202.150 +include:spf.mailjet.com ~all
    Ads.txt Validation Test67% of top 100 sites passed
    • This website is using an Authorized Digital Sellers (ads.txt) file, but it contains duplicated or invalid records! These warnings highlight points of concern which should not affect the processing of the authorized sellers list, but which should be resolved as soon as possible.
    See results list
    Spell Check Test
    Check your webpage for misspellings!

    Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


    seo site checkup logo
    Website SEO, Monitoring & Automation Made Easy.
    Product
    • Pricing
    • Free Tools
    • Articles
    • Login
    • Free 7-Day Trial
    © SEO Site Checkup 2020-2025 • All rights reserved