seo site checkup logo
PricingFree ToolsArticles
Report generated 5 years ago
https://www.vigilanttechno.in
Your general SEO Checkup Score
Archived
67/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 67 out of 100, which is below the average score of 75. However, there are 13 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
13 Failed
3 Warnings
31 Passed
Common SEO issues
Score: 77
Failed: 4
Warnings: 1
Passed: 13
Meta Description Test
  • Congratulations! Your webpage is using a meta description tag
Text: Biometric Fingerprint Time Attendance & Access Control system in Pune Mumbai india,ESSL ZK Biomax Attendance machine dealers distributors, Biometric Attendance system prize cost dealers,CCTV Surveillance System,CCTV Camera in Pune
Google Search Results Preview Test
Desktop version
https://www.vigilanttechno.inBiometric Fingerprint Time Attendance & Access Control system in Pune Mumbai india,ESSL ZK Biomax Attendance machine dealers distributors,CCTV Surveillance System,CCTV Camera in PuneBiometric Fingerprint Time Attendance & Access Control system in Pune Mumbai india,ESSL ZK Biomax Attendance machine dealers distributors, Biometric Attendance system prize cost dealers,CCTV Surveillance System,CCTV Camera in Pune
Mobile version
https://www.vigilanttechno.inBiometric Fingerprint Time Attendance & Access Control system in Pune Mumbai india,ESSL ZK Biomax Attendance machine dealers distributors,CCTV Surveillance System,CCTV Camera in PuneBiometric Fingerprint Time Attendance & Access Control system in Pune Mumbai india,ESSL ZK Biomax Attendance machine dealers distributors, Biometric Attendance system prize cost dealers,CCTV Surveillance System,CCTV Camera in Pune
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
16access14attendance12security11vigilant11development
Keywords Usage Test
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
aadharaccessaccessoriesapplicationapplicationsattendanceautomationbarrierbasedbiometricbiometricsboombracketbuildingbuildingscameracamerascardscareerscctvcommercecontactcontrolcontrollercustomcustomerdatadesigndevelopmentdeviceseaseeasilyefficiencyemailenquiryesslfacefeaturesfilefingerprintflapgmailgraphicguardhardwareheighthighhomehomesidentityimprovedincludeinfointernetleadinglikelocksmanagementmarketingmobilenavigationoffersofficesonlineperformancephoneplethorapriorityproductsproviderpunequalityreaderresourcesrfidsatisfactionsecuresecurityservicessoftwaresoftwaressolutionsstandalonesuperiorsurveillanceswitchsystemstechnotermstimetoggletourtrackingturnstilevarietyvehiclevigilantvirtualvisitorworkforce
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your page contains too many H1 tags. H1 tags should re-inforce the intended topic of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 5 H1 tags.
H1 tags
Biometric Attendance System
CCTV Surveillance System
Visitor Management System
Software Development
Web Development
H2 tags
About us
Latest Products
Robots.txt Test
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test
  • Congratulations! Your website has a sitemap file.
SEO Friendly URL Test
  • Congratulations! All links from your webpage are SEO friendly.
Inline CSS Test
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • Your site either doesn't have a favicon or this has not been referenced correctly.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your webpage.
Social Media Test
  • Your website is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 57
Failed: 5
Warnings: 2
Passed: 7
HTML Page Size Test
  • Congratulations! The size of your webpage's HTML is 7.5 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 39.2 Kb to 7.5 Kb (81% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 1.12 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Total Objects: 33
  • 2 HTML Pages
  • 8 CSS Files
  • 6 JS Files
  • 17 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
CDN Usage Test
  • Your webpage is not serving all resources (images, javascript and css) from CDNs.
See results list
Image Caching Test
  • Your website is not using cache headers for your images. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
JavaScript Caching Test
  • Your website is not using cache headers for your JavaScript resources. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site.
See results list
JavaScript Minification Test
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test
  • Some of your webpage's CSS resources are not minified.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test
  • Your URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Server and security
Score: 63
Failed: 2
Warnings: 0
Passed: 3
URL Canonicalization Test
HTTPS Test
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • We've found 1 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 44
Failed: 2
Warnings: 0
Passed: 6
Structured Data Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Custom 404 Error Page Test
  • Your website is not using a custom 404 error page. Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave your site entirely, and looks unprofessional. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage does not use the canonical link tag.
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
SPF Records Test
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 +a +mx +a:Panther.cms500.com -all
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved