seo site checkup logo
PricingFree ToolsArticles
Report generated a month ago
https://www.universalpavingandconcrete.com
Your general SEO Checkup Score
Archived
76/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 76 out of 100, which is higher than the average score of 75. Our analysis has identified 13 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
13 Failed
4 Warnings
56 Passed
Issues to fix
HIGH
H1 and H2 tags ensure better search engine visibility and ranking by providing structure and hierarchy to the content, improving readability, and providing opportunities for keyword optimization.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
Add a Viewport Meta Tag to optimize this webpage for mobile screens. Without a viewport meta tag, mobile devices may render pages at typical desktop screen widths, resulting in pages being scaled down and difficult to read.
HIGH
Consider using structured data in your webpage as it can help search engines gain a better understanding of your content.
HIGH
Connect your webpage with social media networks using APIs or AddThis, as social signals are becoming increasingly important for search engines to validate a site's trustworthiness and authority.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
LOW
To protect against spam harvesters, consider hiding or obfuscating email addresses in your page code.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Replace deprecated HTML tags with their modern equivalents or appropriate CSS rules.
Common SEO issues
Score: 58
Failed: 7
Warnings: 2
Passed: 16
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Universal Paving and Concrete in Rochester, NY
Length: 46 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 146 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Universal Paving & Concrete offers residential & commercial stamped concrete, hardscapes, ADA ramps, parking lot striping & more in Rochester, NY.
Length: 146 characters
Google Search Results Preview Test
Desktop version
https://www.universalpavingandconcrete.com/Universal Paving and Concrete in Rochester, NYUniversal Paving & Concrete offers residential & commercial stamped concrete, hardscapes, ADA ramps, parking lot striping & more in Rochester, NY.
Mobile version
https://www.universalpavingandconcrete.com/Universal Paving and Concrete in Rochester, NYUniversal Paving & Concrete offers residential & commercial stamped concrete, hardscapes, ADA ramps, parking lot striping & more in Rochester, NY.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:type
website
og:url
https://www.universalpavingandconcrete.com/
og:description
Universal Paving & Concrete offers residential & commercial stamped concrete, hardscapes, ADA ramps, parking lot striping & more in Rochester, NY.
og:title
Universal Paving and Concrete in Rochester, NY
og:image
https://lirp.cdn-website.com/9dc334f6/dms3rep/multi/opt/UPC_RedLogo_0519-1920w.png
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
31concrete20paving19slide19title19write
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
concrete
paving
slide
title
write
Keywords Cloud Test
accessibilityasphaltbackyardbirthdayblogblurredbrushedbuttoncaptionchatcitycommercialcompletecomplianceconcretecontactcontactingdecadesdeliversdrainagedrivewaysdrywallemailerrorestimateestimatesexcellenceexcitedexperienceexpertfairfashionfloorsfreegallerygmailhardscapehavehighhomehonestimprovementincludinginquiryinstallationsjohnlaterlineslivelookinglovemagazinemessageneedsniceofferoopsoutdoorpaintingpatiospavingphonephotoplowingpossiblepreviousprivateprocessqualityquestionreliableremodelingrepairsresidentialresurfacingroadsrochestersendingservicesservingskylineslidesnowsoonsparksstampedstripingtalkteamthanktitletodaytowntrusttrusteduniversalwelcomeworkwriteyears
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage does not contain H1 headings! H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
SEO Friendly URL Test29% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test78% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Inline CSS Test10% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • We found some HTML deprecated tags! You are advised to change these old tags with equivalent tags or proper CSS rules.
12font
Google Analytics Test72% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test27% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html;charset=utf-8
Social Media Test75% of top 100 sites passed
  • This webpage is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 90
Failed: 2
Warnings: 1
Passed: 22
HTML Page Size Test23% of top 100 sites passed
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 961 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 187.91 Kb to 34.62 Kb (82% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 2.42 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
78.2 %
3.34 Mb
javascript
13.4 %
584.72 Kb
font
5.7 %
250.87 Kb
css
1.8 %
79.26 Kb
html
0.8 %
33.47 Kb
other
0.1 %
5.07 Kb
TOTAL
100%
4.27 Mb
Requests by content type
Content type
Percent
Requests
image
44.4 %
36
javascript
33.3 %
27
font
8.6 %
7
css
7.4 %
6
other
4.9 %
4
html
1.2 %
1
TOTAL
100%
81
Content size by domain
Domain
Percent
Size
lirp.cdn-website.com
78.1 %
3.33 Mb
static.cdn-website.com
9.1 %
399.32 Kb
googletagmanager.com
4.9 %
213.31 Kb
irp.cdn-website.com
4.6 %
201.48 Kb
cdn.userway.org
1.6 %
68.93 Kb
universalpavingandconcrete.com
0.8 %
33.47 Kb
google-analytics.com
0.5 %
21.55 Kb
d32hwlnfiv2gyn.cloudfront.net
0.4 %
18.62 Kb
api.userway.org
0.0 %
1.02 Kb
TOTAL
100%
4.27 Mb
Requests by domain
Domain
Percent
Requests
lirp.cdn-website.com
39.5 %
32
static.cdn-website.com
28.4 %
23
irp.cdn-website.com
12.3 %
10
cdn.userway.org
8.6 %
7
google-analytics.com
3.7 %
3
googletagmanager.com
2.5 %
2
d32hwlnfiv2gyn.cloudfront.net
2.5 %
2
universalpavingandconcrete.com
1.2 %
1
api.userway.org
1.2 %
1
TOTAL
100%
81
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test95% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test95% of top 100 sites passed
  • This webpage is not using uncached images from same domain.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is not using uncached JavaScript resources from same domain!
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is not using render-blocking resources.
Nested Tables Test100% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.016 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.016 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 0.960 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

0.96 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 2.26 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

2.26 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<li layout="center" position="center" animation="fadeInUp" show-content="true" color-overlay="true" text-background="true" id="1310388328" class="dmCoverImgContainer flex-active-slide" style="background-image: url("https://lirp.cdn-website.co...">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.2216. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.2216

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Remodeling
Html: <div index="4" class="photoGalleryThumbs animated null" data-index="4">
Score: 0.2071
Server and security
Score: 97
Failed: 1
Warnings: 0
Passed: 9
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.universalpavingandconcrete.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
www.universalpavingandconcrete.com
Subject Alternative Names (SANs)
www.universalpavingandconcrete.com
Not valid before
Sat, May 24o 2025, 4:25:09 pm (z)
Not valid after
Fri, August 22o 2025, 4:25:08 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R11
Intermediate certificate
Common name
R11
Organization
Let's Encrypt
Location
US
Not valid before
Wed, March 13o 2024, 12:00:00 am (z)
Not valid after
Fri, March 12o 2027, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=31536000; preload
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test95% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test97% of top 100 sites passed
  • We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 50
Failed: 1
Warnings: 0
Passed: 2
Meta Viewport Test92% of top 100 sites passed
  • This webpage does not have a viewport meta tag! Add a viewport meta tag to optimize your webpage for mobile screens.
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 60
Failed: 2
Warnings: 1
Passed: 7
Structured Data Test66% of top 100 sites passed
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.universalpavingandconcrete.com/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.universalpavingandconcrete.com/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • The robots.txt file does not use the disallow directive. This means that the whole website can be crawled by search engines.
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test67% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved