seo site checkup logo
PricingFree ToolsArticles
Report generated 7 years ago
http://www.tvlakru.info/sinhala-teledrama
Your general SEO Checkup Score
Archived
100/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 123 out of 100, which is higher than the average score of 75. Our analysis has identified 5 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
5 Failed
2 Warnings
43 Passed
Common SEO issues
Score: 100
Failed: 0
Warnings: 0
Passed: 17
Meta Title Test
  • Congratulations! Your webpage is using a title tag
Text: Recent Sinhala Teledrama - Tvlakru.info
Meta Description Test
  • Congratulations! Your webpage is using a meta description tag
Text: Sinhala Teledrama, Me Adarayai, Adarei Man Adarei, Sidu, Deweni Inima, Prema Dadayama 2, Maharaja Kansa , Ahas Maliga, Chooti Doo, Muthu Ahura, Neela Pabalu, Wes , Shri Gauthama Sambuddha, Sri Siddhartha Gauthama, Prema Dadayama 3, Praveena 2 And Many More.
Google Search Results Preview Test
Desktop version
http://www.tvlakru.info/sinhala-teledramaRecent Sinhala Teledrama - Tvlakru.infoSinhala Teledrama, Me Adarayai, Adarei Man Adarei, Sidu, Deweni Inima, Prema Dadayama 2, Maharaja Kansa , Ahas Maliga, Chooti Doo, Muthu Ahura, Neela Pabalu, Wes , Shri Gauthama Sambuddha, Sri Siddhartha Gauthama, Prema Dadayama 3, Praveena 2 And Many More.
Mobile version
http://www.tvlakru.info/sinhala-teledramaRecent Sinhala Teledrama - Tvlakru.infoSinhala Teledrama, Me Adarayai, Adarei Man Adarei, Sidu, Deweni Inima, Prema Dadayama 2, Maharaja Kansa , Ahas Maliga, Chooti Doo, Muthu Ahura, Neela Pabalu, Wes , Shri Gauthama Sambuddha, Sri Siddhartha Gauthama, Prema Dadayama 3, Praveena 2 And Many More.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
8adarei6gauthama5sinhala5teledrama5muthu
Keywords Usage Test
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
adarayaiadareadareiahasahuraamuthuasipathababharubambaruchootidadayamdadayamadevadewenieliyafollowgauthamahamuwemuhengilainimakansalakrumaharajamaligamathamediaminimodaramohothakmusicmuthuneelanewsnirashanisaobaipabalupahanapandithapoliticalpraveenapremaramarasikayaravanarealityrecentreligioussakkaransambuddhasandasangeethesansaresearchseethaseyashanishrisiddharthasidusihinayakasinhalasoorayasoorayangethsportssrilankasulagateledramathoodutvlakru
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Congratulations! Your webpage contains headings tags.
H1 tags
Recent Sinhala Teledrama.
H2 tags
Sinhala Teledrama, Me Adarayai, Adarei Man Adarei, Sidu, Deweni Inima, Prema Dadayama 2, Maharaja Kansa , Ahas Maliga, Chooti Doo, Muthu Ahura, Neela Pabalu, Wes , Shri Gauthama Sambuddha, Sri Siddhartha Gauthama, Prema Dadayama 3, Praveena 2 And Many More.
Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
Image Alt Test
  • All of your webpage's "img" tags have the required "alt" attribute.
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your webpage.
Speed optimizations
Score: 94
Failed: 1
Warnings: 2
Passed: 8
HTML Page Size Test
  • Congratulations! The size of your webpage's HTML is 5.41 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 41.3 Kb to 5.41 Kb (87% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 0.9 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
Total Objects: 34
  • 1 HTML Pages
  • 3 CSS Files
  • 1 JS Files
  • 29 Images
  • 0 Flash Files
CDN Usage Test
  • Your webpage is not serving all resources (images, javascript and css) from CDNs.
See results list
Image Caching Test
  • Congratulations! Your website is using cache headers for your images and the browsers will display these images from the cache.
JavaScript Caching Test
  • Your webpage is not using uncached JavaScript resources from your domain.
CSS Caching Test
  • Congratulations! Your website is using cache headers for all CSS resources.
JavaScript Minification Test
  • Congratulations! Your website's JavaScript files are minified!
See results list
CSS Minification Test
  • Congratulations! Your webpage's CSS resources are minified.
See results list
URL Redirects Test
  • Your URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Server and security
Score: 73
Failed: 1
Warnings: 0
Passed: 2
URL Canonicalization Test
HTTPS Test
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 80
Failed: 1
Warnings: 0
Passed: 5
Structured Data Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage is using the canonical link tag. This tag specifies that the URL: http://www.tvlakru.info/sinhala-teledrama is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="http://www.tvlakru.info/sinhala-teledrama/" rel="canonical"/>
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file does not use the disallow directive. This means that the whole website can be crawled by search engines.
See results list
SPF Records Test
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 +a +mx +ip4:199.192.21.171 ~all

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved