seo site checkup logo
PricingFree ToolsArticles
Report generated 3 years ago
https://www.theecologycentre.org
Your general SEO Checkup Score
Archived
83/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 83 out of 100, which is higher than the average score of 75. Our analysis has identified 10 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
10 Failed
3 Warnings
56 Passed
Common SEO issues
Score: 87
Failed: 2
Warnings: 2
Passed: 21
Meta Title Test100% of top 100 sites passed
  • Congratulations! Your webpage is using a title tag
Text: Fife | Home | Ecology Centre
Meta Description Test97% of top 100 sites passed
  • Congratulations! Your webpage is using a meta description tag
Text: The Ecology Centre is based by Kinghorn Loch in Fife where we actively use nature and the environment as a tool to improve quality of life.
Google Search Results Preview Test
Desktop version
https://www.theecologycentre.orgFife | Home | Ecology CentreThe Ecology Centre is based by Kinghorn Loch in Fife where we actively use nature and the environment as a tool to improve quality of life.
Mobile version
https://www.theecologycentre.orgFife | Home | Ecology CentreThe Ecology Centre is based by Kinghorn Loch in Fife where we actively use nature and the environment as a tool to improve quality of life.
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:title
Fife | Home | Ecology Centre
og:description
The Ecology Centre is based by Kinghorn Loch in Fife where we actively use nature and the environment as a tool to improve quality of life.
og:image
https://static.wixstatic.com/media/017df6_c97d0cdee0964f7d9dd56d48c3cea7a5~mv2.png/v1/fill/w_612,h_408,al_c/017df6_c97d0cdee0964f7d9dd56d48c3cea7a5~mv2.png
og:image:width
612
og:image:height
408
og:url
https://www.theecologycentre.org
og:site_name
The Ecology Centre
og:type
website
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
5tool4contact4news4shed3ecology
Keywords Usage Test81% of top 100 sites passed
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
abilitiesagesbrandcafecatchcentrechangechangeschangingcharityclosecompanycontactcontentcopyrightcouldndevelopdiscoverdonatedonationdonationseagereasyecologyeducationenvironmenteventsexperiencefifefolaforestforthgrassgrowhandshelphesitatehomeinformationitemsjobskinghornlearnlibrarylifeloadlochmainmakemakingmenumissingnaturalnaturenavigatenestnewsnewslettersnurturepeopleprogrammeprojectrecentrestorationsaveschoolserviceshedsimilarlysiteskipsupportteamtimetoolwantwebsitewelcomewildlifeworld
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • Your page contains too many H1 tags. H1 tags should re-inforce the intended topic of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 5 H1 tags.
H1 tags
Welcome to the Ecology Centre
Support Us
Restoration Forth
News
Tool Shed
EVENTS AT THE ECOLOGY CENTRE
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
  • Congratulations! Your website has a sitemap file.
SEO Friendly URL Test40% of top 100 sites passed
  • Congratulations! All links from your webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • Your webpage is using "img" tags with empty or missing "alt" attribute.
See full list
Responsive Image Test38% of top 100 sites passed
  • All images in this page are properly sized for different users' viewports.
Image Aspect Ratio Test72% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test2% of top 100 sites passed
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • Congratulations! There are no severe JavaScript errors on your webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test80% of top 100 sites passed
  • Congratulations! Your website is connected successfully with social media using:
Facebook Twitter 
Speed optimizations
Score: 87
Failed: 3
Warnings: 0
Passed: 19
HTML Page Size Test34% of top 100 sites passed
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 893 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test96% of top 100 sites passed
  • Congratulations! Your webpage is successfully compressed using br compression on your code. Your HTML is compressed from 630.38 Kb to 121.39 Kb (81% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • Your website loading time is around 2.08 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Content size by content type
Content type
Percent
Size
image
67.7 %
1.42 Mb
javascript
23.1 %
497.60 Kb
html
5.4 %
116.02 Kb
font
2.1 %
45.06 Kb
other
1.8 %
38.60 Kb
css
0.0 %
0 B
TOTAL
100%
2.11 Mb
Requests by content type
Content type
Percent
Requests
javascript
49.4 %
41
image
27.7 %
23
other
19.3 %
16
font
2.4 %
2
html
1.2 %
1
css
0.0 %
0
TOTAL
100%
83
Content size by domain
Domain
Percent
Size
static.wixstatic.com
69.8 %
1.47 Mb
static.parastorage.com
16.5 %
356.68 Kb
theecologycentre.org
12.4 %
267.92 Kb
siteassets.parastorage.com
1.2 %
26.85 Kb
frog.wix.com
0.0 %
781 B
TOTAL
100%
2.11 Mb
Requests by domain
Domain
Percent
Requests
static.parastorage.com
48.2 %
40
static.wixstatic.com
30.1 %
25
frog.wix.com
12.0 %
10
theecologycentre.org
4.8 %
4
siteassets.parastorage.com
4.8 %
4
TOTAL
100%
83
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • Your webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Caching Test99% of top 100 sites passed
  • Your webpage is not using uncached images from your domain.
JavaScript Caching Test98% of top 100 sites passed
  • Congratulations! Your website is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • Your webpage is not using uncached CSS resources from your domain.
JavaScript Minification Test93% of top 100 sites passed
  • Congratulations! Your website's JavaScript files are minified!
See results list
CSS Minification Test97% of top 100 sites passed
  • Your webpage is not using CSS resources from the same domain.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is not using render-blocking resources.
Nested Tables Test99% of top 100 sites passed
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • Congratulations! Your webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 1.86 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

1.86 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img src="https://static.wixstatic.com/media/16f9d351f1b748c..." alt="Enjoying the Woods" style="width: 930px; height: 1080px; object-fit: cover; o...">
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.345. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.

0.345

0.1

0.25

DOM element which contributes the most to CLS score:
Html: <div id="bgLayers_comp-l0pe0a6b" data-hook="bgLayers" class="_3wnIc">
Score: 0.345
Server and security
Score: 91
Failed: 1
Warnings: 0
Passed: 8
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.theecologycentre.org" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
theecologycentre.org
Subject Alternative Names (SANs)
theecologycentre.org, www.theecologycentre.org
Not valid before
Thu, May 12o 2022, 12:00:00 am (z)
Not valid after
Wed, August 10o 2022, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Sectigo RSA Domain Validation Secure Server CA
Intermediate certificate
Common name
Sectigo RSA Domain Validation Secure Server CA
Organization
Sectigo Limited
Location
Salford, Greater Manchester, GB
Not valid before
Fri, November 2o 2018, 12:00:00 am (z)
Not valid after
Tue, December 31o 2030, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
Root certificate
Common name
USERTrust RSA Certification Authority
Organization
The USERTRUST Network
Location
Jersey City, New Jersey, US
Not valid before
Mon, February 1o 2010, 12:00:00 am (z)
Not valid after
Mon, January 18o 2038, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • Congratulations, this webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
Safe Browsing Test100% of top 100 sites passed
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
Server: Pepyaka/1.19.10
Directory Browsing Test100% of top 100 sites passed
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test93% of top 100 sites passed
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 62
Failed: 1
Warnings: 0
Passed: 2
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test99% of top 100 sites passed
  • Your website is not using media queries. You should consider using this technique in order to implement responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 43
Failed: 3
Warnings: 1
Passed: 6
Structured Data Test59% of top 100 sites passed
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Custom 404 Error Page Test75% of top 100 sites passed
  • Your website is not using a custom 404 error page. Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave your site entirely, and looks unprofessional. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test99% of top 100 sites passed
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://www.theecologycentre.org is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.theecologycentre.org" rel="canonical"/>
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
Meta Refresh Test95% of top 100 sites passed
  • Congratulations, this webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test80% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved