seo site checkup logo
PricingFree ToolsArticles
Report generated 10 months ago
https://www.sellfiredamagedhousecalifornia.com
Your general SEO Checkup Score
Archived
93/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 93 out of 100, which is higher than the average score of 75. Our analysis has identified 13 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
13 Failed
2 Warnings
57 Passed
Issues to fix
HIGH
Add a meta description tag to provide a brief and informative summary of the page's content for search engines.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
Add a Viewport Meta Tag to optimize this webpage for mobile screens. Without a viewport meta tag, mobile devices may render pages at typical desktop screen widths, resulting in pages being scaled down and difficult to read.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
Add descriptive and relevant "alt" attributes to all "img" tags to improve website accessibility.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
Common SEO issues
Score: 59
Failed: 5
Warnings: 1
Passed: 16
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Sell Fire Damaged House California [We're Local]
Length: 48 characters
Meta Description Test96% of top 100 sites passed
  • This webpage is not using a meta description tag! You should include this tag in order to provide a brief description of your page which can be used by search engines. Well-written and inviting meta descriptions may also help click-through rates to your site in search engine results.
Google Search Results Preview Test
Desktop version
https://www.sellfiredamagedhousecalifornia.com/Sell Fire Damaged House California [We're Local]
Mobile version
https://www.sellfiredamagedhousecalifornia.com/Sell Fire Damaged House California [We're Local]
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:type
website
og:title
Sell Fire Damaged House California [We're Local]
og:image
https://lirp.cdn-website.com/cc3b216d/dms3rep/multi/opt/logo+transparency+california-1920w.png
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
75house64damaged43cash41damage40selling
Keywords Usage Test45% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
house
damaged
cash
damage
selling
Keywords Cloud Test
addressagentagentsassessbeachbestbuyerbuyerscaliforniacashchallengingcityclaimclientclosingcontactingcontractorcostcostscrucialdamagedamageddecisiondistressdoesneastemailemotionalerrorestateexperiencefairfastfeesfinancialformfreehappyhasslehavehavinghighhillshomehomeownershomeshousehousesimportantinsuranceinvestorslakelaterlegallindalowermakemakingmarketmeansmessagemortgageneedofferoffersoopsoptionsparkphonepossiblepotentialpracticespriceprocesspropertiespropertyquickranchorealrepairrepairsresearchrestorationreviewssalesantasellsellerssellingsendingservicesimplesituationsoonsouththankvalleyvaluevistawest
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test59% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Sell Your
Fire Damaged House California [We're Local]
H2 tags
What is a fire-damaged house?
We Buy Fire Damaged Homes AS IS
Can I Sell a Fire-Damaged House in California?
How To Sell A House As Is
Sell Fire Damaged House California!
Selling AS IS - Fast & Easy!
Reasons to Sell Your House After Fire Damage California
What You Should Do After a House Fire in California
Get Cash For My Home!
Selling a House With Fire-Damaged in California Options
So Many Satisfied Home Sellers!
We Buy fire damaged homes all over CA
Sell Your Home As-Is Today!
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test74% of top 100 sites passed
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test28% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test65% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test79% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test41% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html;charset=utf-8
Speed optimizations
Score: 76
Failed: 5
Warnings: 0
Passed: 15
HTML Page Size Test21% of top 100 sites passed
DOM Size Test54% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 5,584 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 448.34 Kb to 106.31 Kb (76% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test66% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 7.01 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test71% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
45.7 %
975.36 Kb
javascript
37.3 %
797.46 Kb
font
8.7 %
186.17 Kb
html
4.9 %
104.11 Kb
css
3.3 %
70.34 Kb
other
0.1 %
2.70 Kb
TOTAL
100%
2.09 Mb
Requests by content type
Content type
Percent
Requests
javascript
42.9 %
18
image
31.0 %
13
css
11.9 %
5
font
9.5 %
4
html
2.4 %
1
other
2.4 %
1
TOTAL
100%
42
Content size by domain
Domain
Percent
Size
lirp.cdn-website.com
45.0 %
961.83 Kb
gstatic.com
25.7 %
547.96 Kb
static.cdn-website.com
16.9 %
361.04 Kb
irp.cdn-website.com
6.6 %
141.64 Kb
sellfiredamagedhousecalifornia.com
4.9 %
104.11 Kb
d32hwlnfiv2gyn.cloudfront.net
0.9 %
18.59 Kb
google.com
0.0 %
989 B
TOTAL
100%
2.09 Mb
Requests by domain
Domain
Percent
Requests
static.cdn-website.com
45.2 %
19
lirp.cdn-website.com
23.8 %
10
irp.cdn-website.com
19.0 %
8
d32hwlnfiv2gyn.cloudfront.net
4.8 %
2
sellfiredamagedhousecalifornia.com
2.4 %
1
google.com
2.4 %
1
gstatic.com
2.4 %
1
TOTAL
100%
42
CDN Usage Test97% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test38% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test97% of top 100 sites passed
  • This webpage is not using uncached images from same domain.
JavaScript Caching Test95% of top 100 sites passed
  • This webpage is not using uncached JavaScript resources from same domain!
CSS Caching Test96% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test96% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test10% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test98% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.010 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.01 s

0.8 s

1.8 s

First Contentful Paint Test94% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 1.707 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

1.707 s

1.8 s

3 s

Largest Contentful Paint Test90% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 1.71 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

1.71 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: FIRE DAMAGED HOUSE CALIFORNIA [WE'RE LOCAL] 
Html: <h1 class="text-align-center m-size-24">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.0030. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.003

0.1

0.25

DOM element which contributes the most to CLS score:
Html:
Score: 0.0024
Server and security
Score: 91
Failed: 1
Warnings: 0
Passed: 6
URL Canonicalization Test97% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.sellfiredamagedhousecalifornia.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
www.sellfiredamagedhousecalifornia.com
Subject Alternative Names (SANs)
sellfiredamagedhousecalifornia.com, www.sellfiredamagedhousecalifornia.com
Not valid before
Wed, December 18o 2024, 7:34:46 am (z)
Not valid after
Tue, March 18o 2025, 7:34:45 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R10
Intermediate certificate
Common name
R10
Organization
Let's Encrypt
Location
US
Not valid before
Wed, March 13o 2024, 12:00:00 am (z)
Not valid after
Fri, March 12o 2027, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test100% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test82% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=31536000; preload
Plaintext Emails Test100% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 50
Failed: 1
Warnings: 0
Passed: 2
Meta Viewport Test88% of top 100 sites passed
  • This webpage does not have a viewport meta tag! Add a viewport meta tag to optimize your webpage for mobile screens.
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 98
Failed: 0
Warnings: 1
Passed: 8
Structured Data Test53% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test67% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test98% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.sellfiredamagedhousecalifornia.com/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.sellfiredamagedhousecalifornia.com/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • The robots.txt file does not use the disallow directive. This means that the whole website can be crawled by search engines.
See results list
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test95% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:spf.efwd.registrar-servers.com ~all
Ads.txt Validation Test68% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved