seo site checkup logo
PricingFree ToolsArticles
Report generated a month ago
https://www.sastaticket.pk
Your general SEO Checkup Score
Archived
74/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 74 out of 100, which is below the average score of 75. However, there are 15 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
15 Failed
4 Warnings
49 Passed
Issues to fix
HIGH
To provide a good user experience, Google recommends that sites should aim for a Largest Contentful Paint duration of 2.5 seconds or less.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
MEDIUM
Reducing the JavaScript execution time can result in faster page load times and a smoother user experience, as it allows the browser to render and display the page more quickly.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
MEDIUM
Using social media meta tags can improve the appearance and content of shared links on social media platforms, potentially increasing click-through rates and engagement with the page.
LOW
A proper character encoding declaration ensures that all characters, including non-ASCII characters, are displayed correctly in the browser, improving the readability and usability of the webpage.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 64
Failed: 6
Warnings: 3
Passed: 16
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Sastaticket.pk - Cheap Flights, Buses and Holiday Packages
Length: 58 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 58 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Sastaticket.pk - Cheap Flights, Buses and Holiday Packages
Length: 58 characters
Google Search Results Preview Test
Desktop version
https://www.sastaticket.pk/Sastaticket.pk - Cheap Flights, Buses and Holiday PackagesSastaticket.pk - Cheap Flights, Buses and Holiday Packages
Mobile version
https://www.sastaticket.pk/Sastaticket.pk - Cheap Flights, Buses and Holiday PackagesSastaticket.pk - Cheap Flights, Buses and Holiday Packages
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is not using social media meta tags! While this type of meta tags don't affect what people see when they visit the webpage, they exist to provide information about it to search engines and social media platforms.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
44customer40verified29pakistan25hours23review
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
customer
verified
pakistan
hours
review
Keywords Cloud Test
accountafricaahmadairlinesairportairwaysameenanonymousattitudebalancebankbookedbookingsbusescardchargechargescityconsumingcontactcustomercustomersdebitdeducteddomesticdubaieasyespeciallyexcellentexistingexperienceextrafaisalabadflightsflyingfrequentfrustratinggettinggoodguidehavehelpfulhelplinehighhigherhoursinternationalislamabadissuesjohannesburgkarachikeptkhanlahorelateliaquatloggedluggagemakemodernnicenooronlineoverallpakistanpatheticpaymentpersonpeshawarplentyqualityreducedrefundreviewroomsafesanasastaticketsatisfiedsavesearchserviceshahidsheikhsofiasouthstandardstoragesupportticketticketstimetraveltryingtwiceusageusersverifiedwhatsappyasin
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains too many H1 tags! H1 tags should re-inforce the intended topic of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 5 H1 tags.
H1 tags
700k+
300k+
50k+
20m+
Featured Partners
Domestic & International
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
  • This website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test29% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test78% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test10% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test27% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a meta charset tag but is not fully contained in the first 1024 bytes of the HTML document! The element containing the character encoding declaration must be serialized completely within the first 1024 bytes of the document, otherwise it can significantly affect load performance.
Speed optimizations
Score: 70
Failed: 6
Warnings: 0
Passed: 17
HTML Page Size Test23% of top 100 sites passed
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 2,743 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 3168.86 Kb to 478.72 Kb (85% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 2.22 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in more than 3.5 seconds! When the JavaScript code takes a long time to execute, it slows down the page performance in several ways: longer download times, main thread bottlenecks, delays of "Time To Interactive", memory leaks, etc.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
javascript
71.4 %
2.69 Mb
image
24.0 %
927.74 Kb
css
1.6 %
62.77 Kb
html
1.4 %
52.73 Kb
font
0.9 %
35.07 Kb
other
0.7 %
26.33 Kb
TOTAL
100%
3.77 Mb
Requests by content type
Content type
Percent
Requests
image
45.1 %
46
javascript
28.4 %
29
other
14.7 %
15
html
4.9 %
5
css
3.9 %
4
font
2.9 %
3
TOTAL
100%
102
Content size by domain
Domain
Percent
Size
sastaticket.pk
62.6 %
2.36 Mb
googletagmanager.com
9.9 %
383.22 Kb
gstatic.com
6.7 %
260.50 Kb
s3.ap-south-1.amazonaws.com
5.3 %
205.56 Kb
ssl.widgets.webengage.com
2.9 %
112.40 Kb
dev.visualwebsiteoptimizer.com
2.4 %
92.93 Kb
connect.facebook.net
2.2 %
83.97 Kb
script.hotjar.com
1.4 %
55.97 Kb
google.com
1.1 %
41.53 Kb
assets.reviews.io
1.0 %
37.33 Kb
Other
4.4 %
170.23 Kb
TOTAL
100%
3.77 Mb
Requests by domain
Domain
Percent
Requests
s3.ap-south-1.amazonaws.com
29.4 %
30
sastaticket.pk
16.7 %
17
dev.visualwebsiteoptimizer.com
5.9 %
6
assets.reviews.io
3.9 %
4
googletagmanager.com
3.9 %
4
google.com
3.9 %
4
google-analytics.com
3.9 %
4
o.clarity.ms
3.9 %
4
clarity.ms
2.9 %
3
gstatic.com
2.9 %
3
Other
22.5 %
23
TOTAL
100%
102
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
Modern Image Format Test43% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test95% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is not using render-blocking resources.
Nested Tables Test100% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.516 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.516 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 0.760 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

0.76 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 6.68 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

6.68 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: Travel Bookings Made Easy Flights Buses Visas Holiday Packages One WayReturnMult...
Html: <div class="_3E4Vc-PW-NkvQMIgdfYlI- pb-6">
Server and security
Score: 89
Failed: 1
Warnings: 1
Passed: 7
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.sastaticket.pk" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
sastaticket.pk
Subject Alternative Names (SANs)
sastaticket.pk, *.sastaticket.pk
Not valid before
Tue, February 25o 2025, 3:04:50 am (z)
Not valid after
Mon, May 26o 2025, 4:04:43 am (z)
Signature algorithm
ecdsaWithSha256
Issuer
WE1
Intermediate certificate
Common name
WE1
Organization
Google Trust Services
Location
US
Not valid before
Wed, December 13o 2023, 9:00:00 am (z)
Not valid after
Tue, February 20o 2029, 2:00:00 pm (z)
Signature algorithm
ecdsaWithSha384
Issuer
GTS Root R4
Root certificate
Common name
GTS Root R4
Organization
Google Trust Services LLC
Location
US
Not valid before
Wed, June 22o 2016, 12:00:00 am (z)
Not valid after
Sun, June 22o 2036, 12:00:00 am (z)
Signature algorithm
ecdsaWithSha384
Issuer
GTS Root R4
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol but not all resources are served over this protocol!
See results list
HSTS Test84% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test95% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 94
Failed: 2
Warnings: 0
Passed: 6
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.sastaticket.pk/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.sastaticket.pk" rel="canonical"/>
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
Ads.txt Validation Test67% of top 100 sites passed
  • The request of ads.txt file has an unexpected Content-Type header: text/html. In order for this resource to be easily accessed by the DSPs and advertisers, its Content-Type header should be text/plain or text/plain; charset=utf-8.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved