seo site checkup logo
PricingFree ToolsArticles
Report generated 9 years ago
http://www.roundandblack.co.uk
Your general SEO Checkup Score
Archived
77/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 77 out of 100, which is higher than the average score of 75. Our analysis has identified 10 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
10 Failed
1 Warnings
30 Passed
Common SEO issues
Score: 62
Failed: 4
Warnings: 1
Passed: 10
Google Search Results Preview
Desktop version
http://www.roundandblack.co.uk/Round and Black | Quality Motorcycle Tyres at Low PricesRound and Black
Mobile version
http://www.roundandblack.co.uk/Round and Black | Quality Motorcycle Tyres at Low PricesRound and Black
Keywords Cloud
accessoriesaccountalloyalpinestarsangelantiapriliaattackavonbattleblackbridgestonecarboncartcityclassiccobracompconticontinentalcrossdemondiablodunlopendsenduroexedrafibregripsharleyhighhomehondahyperinnerinteractkneel@@klocksmarathonmaxxismetzelermichelinmilestonemopedmotorcyclemotoxoxfordpadspairperformancepilotpirellipowerpremiumpricesproductspurequalifierqualityrangerearroadroadsmartroadtecscooterscorpionsearchslicksslidersslipsportsportecsportsmartstockstompgripstompgripsstrykesupercorsasupermaxxsuzukitanktourancetouringtrailtriumphtubestwisttyretyresultrauniversalvenomviewviperwetswhitewallwhitewallswingyamaha
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test
  • Congratulations! We've found 1 sitemap file for your website:
SEO Friendly URL Test
  • Congratulations! All links from your webpage are SEO friendly.
Image Alt Test
  • Your webpage has 48 'img' tags and 1 of them are missing the required 'alt' attribute.
See full list
Inline CSS Test
  • Your webpage is using 9 inline CSS styles!
See results list
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Your website does not include a Google Analytics tracker script or this script is not properly installed. You are advised to use Google Analytics and properly install the tracker script in order to get detailed statistics about your website's traffic and traffic sources.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your web page.
Social Media Check
  • Your website is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 76
Failed: 3
Warnings: 0
Passed: 8
HTML Page Size Test
  • Congratulations! Your HTML size is 19.62 Kb and this is under the average web page size of 33 Kb.
    This leads to a faster page loading time than average.
HTML Compression/GZIP Test
  • Congratulations! Your page is successfully compressed using gzip compression on your code.
    Your HTML is compressed from 169.21 Kb to 19.62 Kb (88 % size savings). This helps ensure a faster loading web page and improved user experience.
Site Loading Speed Test
  • Your site loading time is around 5.152 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 92
  • 2 HTML Pages
  • 7 CSS Files
  • 30 JS Files
  • 53 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduce server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
Image Caching Test
  • Your site is not using expires headers for your images. An expires tag can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Checker
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 89
Failed: 1
Warnings: 0
Passed: 5
URL Canonicalization Test
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 50
Failed: 2
Warnings: 0
Passed: 4
Microdata Schema Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Checker
  • Your webpage use the noindex meta tag. This means that your webpage will be read but not indexed by search engines.
See results list
Canonical Tag Checker
  • Your page does not use the canonical link tag.
Nofollow Checker
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
Disallow Directive Checker
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
SPF records checker
  • Congratulations! Your DNS server is using an SPF record. This SPF record is listed below:
\"v=spf1 a mx a:exchange.universal-tyres.co.uk include:mailhost.zen.co.uk -all\

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved