seo site checkup logo
PricingFree ToolsArticles
Report generated 3 months ago
https://www.rideus.xyz
Your general SEO Checkup Score
Archived
98/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 98 out of 100, which is higher than the average score of 75. Our analysis has identified 14 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
14 Failed
3 Warnings
55 Passed
Issues to fix
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
To provide a good user experience, Google recommends that sites should aim for a First Contentful Paint value of 1.8 seconds or less.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
LOW
Use only one canonical link tag per webpage, as multiple tags will cause search engines to ignore all of them, potentially leading to duplicate content issues.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
LOW
To protect against spam harvesters, consider hiding or obfuscating email addresses in your page code.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
Common SEO issues
Score: 76
Failed: 3
Warnings: 2
Passed: 17
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 69 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Rideus - Best Self Drive Car Rental in Bhubaneswar | Affordable Rates
Length: 69 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 404 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: RideUs is Bhubaneswar’s trusted self-drive car rental service, offering a wide range of well-maintained cars — from hatchbacks to SUVs and luxury vehicles. Rent a car by the hour, day, or week with zero hassles, transparent pricing, and instant online booking. Whether it’s a weekend getaway, business travel, or airport pickup, RideUs lets you drive your way across Bhubaneswar with comfort and freedom.
Length: 404 characters
Google Search Results Preview Test
Desktop version
https://rideus.xyz/Rideus - Best Self Drive Car Rental in Bhubaneswar | Affordable RatesRideUs is Bhubaneswar’s trusted self-drive car rental service, offering a wide range of well-maintained cars — from hatchbacks to SUVs and luxury vehicles. Rent a car by the hour, day, or week with zero hassles, transparent pricing, and instant online booking. Whether it’s a weekend getaway, business travel, or airport pickup, RideUs lets you drive your way across Bhubaneswar with comfort and freedom.
Mobile version
https://rideus.xyz/Rideus - Best Self Drive Car Rental in Bhubaneswar | Affordable RatesRideUs is Bhubaneswar’s trusted self-drive car rental service, offering a wide range of well-maintained cars — from hatchbacks to SUVs and luxury vehicles. Rent a car by the hour, day, or week with zero hassles, transparent pricing, and instant online booking. Whether it’s a weekend getaway, business travel, or airport pickup, RideUs lets you drive your way across Bhubaneswar with comfort and freedom.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:title
Rideus - Best Self Drive Car Rental in Bhubaneswar | Affordable Rates
og:description
Rideus is a premium self drive car rental service offering a wide range of vehicles in Bhubaneswar. Book instantly with flexible pricing, 24/7 support, and a seamless online experience. Whether it's a weekend getaway, a business trip, or a daily commute—Rideus puts the road in your hands.
og:type
website
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
153bhubaneswar109rental98drive94self79read
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
bhubaneswar
rental
drive
self
read
Keywords Cloud Test
affordableairportancientareasbestbhubaneswarbikebookbookingbusinesscapitalcarschoosecitycontrolconvenienceconvenientcustomerdailydeltademanddiscoverdiversedrivedrivingenjoyexperienceexploreexploringfantasticfeaturesfleetflexiblefreefreedomfriendlygetawaysgreathasslehavehirehourhourlyindiajourneyjulyjunejustlocationlookingluxurymaintainedmanualmarutimodernmonthlyneedneedsodishaofferofferingoptionspaceperfectpetrolpickupplanspremiumpricingprivacyprocessprovidingrailwayreadreliablerentrentalrentalsrideusroadseamlessseatsselfserviceservicessnehastationsupportsuvssuzukitemplestimetransportationtraveltripuservehiclevehiclesvibrantweekend
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Drive Your Adventure
H2 tags
Our Top-Rated Fleet
Why Choose Us
What Our Customers Say
Our Journey So Far
Frequently Asked Questions
Offers Section
From Our Blog
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
  • This website has a sitemap file.
Image Alt Test78% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test27% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Speed optimizations
Score: 78
Failed: 5
Warnings: 1
Passed: 14
HTML Page Size Test23% of top 100 sites passed
  • The size of this webpage's HTML is 26.92 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 2,180 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 262.76 Kb to 26.92 Kb (90% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 0.41 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
96.7 %
14.67 Mb
javascript
3.1 %
483.56 Kb
css
0.1 %
15.20 Kb
html
0.1 %
13.78 Kb
other
0.0 %
42 B
font
0.0 %
0 B
TOTAL
100%
15.17 Mb
Requests by content type
Content type
Percent
Requests
image
55.7 %
44
javascript
32.9 %
26
html
7.6 %
6
css
2.5 %
2
other
1.3 %
1
font
0.0 %
0
TOTAL
100%
79
Content size by domain
Domain
Percent
Size
rideus.xyz
98.1 %
14.88 Mb
maps.googleapis.com
1.5 %
238.01 Kb
maps.gstatic.com
0.4 %
59.57 Kb
google.com
0.0 %
1.44 Kb
TOTAL
100%
15.17 Mb
Requests by domain
Domain
Percent
Requests
rideus.xyz
82.3 %
65
maps.googleapis.com
15.2 %
12
google.com
1.3 %
1
maps.gstatic.com
1.3 %
1
TOTAL
100%
79
CDN Usage Test95% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test95% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test97% of top 100 sites passed
  • This URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.197 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.197 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 3.779 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

3.779 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 1.3 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

1.3 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<div class="absolute inset-0 bg-cover bg-center bg-no-repeat h..." style="background-image: url("/images/Rideus_BG1_Desktop....">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0000. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.
0
Server and security
Score: 95
Failed: 1
Warnings: 0
Passed: 6
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "rideus.xyz" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
rideus.xyz
Subject Alternative Names (SANs)
*.rideus.xyz, rideus.xyz
Not valid before
Wed, June 25o 2025, 12:06:45 pm (z)
Not valid after
Tue, September 23o 2025, 12:06:44 pm (z)
Signature algorithm
ecdsaWithSha384
Issuer
E6
Intermediate certificate
Common name
E6
Organization
Let's Encrypt
Location
US
Not valid before
Wed, March 13o 2024, 12:00:00 am (z)
Not valid after
Fri, March 12o 2027, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=31536000
Plaintext Emails Test97% of top 100 sites passed
  • We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 46
Failed: 4
Warnings: 0
Passed: 5
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • We've found multiple canonical link tags. When more than one is specified, all canonical tags will be ignored!
<link href="https://rideus.xyz/" rel="canonical"/>
<link data-react-helmet="true" href="https://rideus.xyz/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test67% of top 100 sites passed
  • The request of ads.txt file has an unexpected Content-Type header: text/html; charset=UTF-8. In order for this resource to be easily accessed by the DSPs and advertisers, its Content-Type header should be text/plain or text/plain; charset=utf-8.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved