seo site checkup logo
PricingFree ToolsArticles
Report generated 20 days ago
https://www.resourceworldwide.co.uk
Your general SEO Checkup Score
Archived
90/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 90 out of 100, which is higher than the average score of 75. Our analysis has identified 6 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
6 Failed
2 Warnings
53 Passed
Issues to fix
HIGH
Add descriptive and relevant "alt" attributes to all "img" tags to improve website accessibility.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
LOW
Consider reducing the HTML size to improve loading times and retain visitors.
LOW
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
Common SEO issues
Score: 81
Failed: 3
Warnings: 1
Passed: 18
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Resource Worldwide | highly skilled remote professionals
Length: 56 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: At Resource Worldwide, we use our alternative approach to recruitment to help businesses find the skilled and talented individuals they’re looking for. Highly skilled remote professionals
Length: 187 characters
Google Search Results Preview Test
Desktop version
https://www.resourceworldwide.co.uk/Resource Worldwide | highly skilled remote professionalsAt Resource Worldwide, we use our alternative approach to recruitment to help businesses find the skilled and talented individuals they’re looking for. Highly skilled remote professionals
Mobile version
https://www.resourceworldwide.co.uk/Resource Worldwide | highly skilled remote professionalsAt Resource Worldwide, we use our alternative approach to recruitment to help businesses find the skilled and talented individuals they’re looking for. Highly skilled remote professionals
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:title
Resource Worldwide | highly skilled remote professionals
og:description
At Resource Worldwide, we use our alternative approach to recruitment to help businesses find the skilled and talented individuals they’re looking for. Highly skilled remote professionals
og:image
https://static.wixstatic.com/media/95dc86_45f07aef84ea4981963ce9adb5abae8f~mv2.png/v1/fill/w_1920,h_941,al_c/95dc86_45f07aef84ea4981963ce9adb5abae8f~mv2.png
og:image:width
1920
og:image:height
941
og:url
https://www.resourceworldwide.co.uk
og:site_name
Resource Worldwide
og:type
website
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
35businesses34team30skilled28remote28worldwide
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
businesses
team
skilled
remote
worldwide
Keywords Cloud Test
alternativeapproachassistantavenuesbelievebestbookbuildbusinessbusinessescandidatescasechallengeclarifycompaniescompetitiveconcernsconsultationcostcostscovereddiscussdiscussingeasyexceptionallyexpertsexplorefindinggreatgrowinggrowthhalfwayhavehelphighhighlyhirehiringigasindustriesindustrylogisticslookingmaintainmarketmatchmattersmemberneedopinionopportunityoutsideoutsourcepeopleproblemprofessionalprofessionalsprovidequalityreadreallyrecruitmentremoteresourceretentionrightrolerolesscottshareshowcasingsimonsimplyskilledskillssolvedspeakstaffstaffingstandardsstayostoriesstorystrugglingsuccesssupporttalentteamthingthinktimetrustunderstanduntappedvirtualworkworkingworldworldwideyears
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains too many H1 tags! H1 tags should re-inforce the intended topic of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 5 H1 tags.
H1 tags
The smarter way to hire skilled people
Our Latest Blogs
Speak with a member of our team to find out how we can help.
The smarter way to hire skilled people
Challenge us to fill your role
The smarter way to hire skilled people
H2 tags
Meet Resource Worldwide
Our alternative approach to recruitment is already helping 100s of businesses find skilled and talented people they need.
Top Companies Who Trust Us
Everything you need to build your best team. Easily.
Industry Experts
Our alternative approach to recruitment is already helping 100s of businesses find skilled people they need.
Challenge us to fill your role
Skilled Remote Professionals
Trusted by growing businesses all over the world
10 Reasons Why You Should Hire a Remote Professional
Company Culture and Remote Professionals
The Problem of the Skills Gap in the UK
Want to learn more?
Challenge us to fill your role.
The numbers don't lie...
3x
Struggling to fill a role?
79%
97%
Designed for growing businesses
£1m+
Challenge Us To
Fill Your Role
Used by companies all over the world, from SMEs to enterprises
10,000+
40%
Meet Resource Worldwide.
Book a Call
Setup
The Search
Ongoing Support
Four steps to filling your roles
Still not sure? Tell us what’s bothering you.
​​​
Outstanding Talent
Flexible and Fast
Risk Free
Full Service
Pre-Vetted Professionals
Compliance & HR Experts
Flexibility
Client Success Team
How can we help you?
Highly skilled people for 40% less
Created for growth
We are on a mission to solve the skills shortage
Keep updated on our latest candidates
Trusted by growing businesses all over the world.
Outstanding talent
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
  • This website has a sitemap file.
Image Alt Test78% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test29% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test75% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test27% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Speed optimizations
Score: 93
Failed: 3
Warnings: 0
Passed: 17
HTML Page Size Test23% of top 100 sites passed
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 3,874 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 3398.55 Kb to 426.56 Kb (87% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 3.5 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
javascript
34.0 %
764.25 Kb
font
23.9 %
537.31 Kb
other
18.0 %
404.48 Kb
html
17.6 %
396.08 Kb
image
6.5 %
146.12 Kb
css
0.1 %
2.31 Kb
TOTAL
100%
2.20 Mb
Requests by content type
Content type
Percent
Requests
javascript
55.2 %
91
image
23.0 %
38
other
14.5 %
24
font
4.2 %
7
css
2.4 %
4
html
0.6 %
1
TOTAL
100%
165
Content size by domain
Domain
Percent
Size
static.parastorage.com
34.5 %
775.51 Kb
static.wixstatic.com
31.4 %
705.91 Kb
resourceworldwide.co.uk
18.4 %
413.08 Kb
siteassets.parastorage.com
15.7 %
352.73 Kb
browser.sentry-cdn.com
0.1 %
1.58 Kb
panorama.wixapps.net
0.0 %
1.00 Kb
frog.wix.com
0.0 %
625 B
api.popcorn.email
0.0 %
144 B
TOTAL
100%
2.20 Mb
Requests by domain
Domain
Percent
Requests
static.parastorage.com
55.8 %
92
static.wixstatic.com
27.9 %
46
resourceworldwide.co.uk
4.8 %
8
frog.wix.com
4.8 %
8
panorama.wixapps.net
3.6 %
6
siteassets.parastorage.com
1.8 %
3
browser.sentry-cdn.com
0.6 %
1
api.popcorn.email
0.6 %
1
TOTAL
100%
165
CDN Usage Test95% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test95% of top 100 sites passed
  • This webpage is not using uncached images from same domain.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is not using uncached JavaScript resources from same domain!
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is not using render-blocking resources.
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.014 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.014 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 0.632 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

0.632 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 0.63 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

0.63 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: Our alternative approach to recruitment is already helping 100s of businesses fi...
Html: <h2 class="font_2 wixui-rich-text__text">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0048. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0048

0.1

0.25

DOM element which contributes the most to CLS score:
Html:
Score: 0.0048
Server and security
Score: 100
Failed: 0
Warnings: 0
Passed: 7
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.resourceworldwide.co.uk" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
resourceworldwide.co.uk
Subject Alternative Names (SANs)
resourceworldwide.co.uk, www.resourceworldwide.co.uk
Not valid before
Wed, August 13o 2025, 5:54:53 pm (z)
Not valid after
Tue, November 11o 2025, 5:54:52 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R11
Intermediate certificate
Common name
R11
Organization
Let's Encrypt
Location
US
Not valid before
Wed, March 13o 2024, 12:00:00 am (z)
Not valid after
Fri, March 12o 2027, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=86400
Plaintext Emails Test97% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 98
Failed: 0
Warnings: 1
Passed: 8
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.resourceworldwide.co.uk/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.resourceworldwide.co.uk" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:_spf.google.com ~all
Ads.txt Validation Test67% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved