seo site checkup logo
PricingFree ToolsArticles
Report generated 17 days ago
https://www.purchasingpower.com/about-purchasing-power
Your general SEO Checkup Score
Archived
65/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 65 out of 100, which is below the average score of 75. However, there are 20 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
20 Failed
4 Warnings
50 Passed
Issues to fix
HIGH
To provide a good user experience, Google recommends that sites should aim for a Largest Contentful Paint duration of 2.5 seconds or less.
HIGH
It is recommended to avoid URL parameters and to use hyphens to separate words in the URL structure, rather than underscores.
HIGH
Consider using structured data in your webpage as it can help search engines gain a better understanding of your content.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
Add descriptive and relevant "alt" attributes to all "img" tags to improve website accessibility.
HIGH
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
Add a robots.txt file to properly communicate with web crawlers and prevent unwanted access to sensitive content.
MEDIUM
To enhance website performance, it is recommended to implement a caching mechanism that delivers static HTML content.
MEDIUM
To provide a good user experience, Google recommends that sites should aim for a First Contentful Paint value of 1.8 seconds or less.
MEDIUM
Reducing the JavaScript execution time can result in faster page load times and a smoother user experience, as it allows the browser to render and display the page more quickly.
MEDIUM
Using social media meta tags can improve the appearance and content of shared links on social media platforms, potentially increasing click-through rates and engagement with the page.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
A proper character encoding declaration ensures that all characters, including non-ASCII characters, are displayed correctly in the browser, improving the readability and usability of the webpage.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
For security reasons, it is recommended to turn off the server signature.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
Common SEO issues
Score: 66
Failed: 7
Warnings: 1
Passed: 18
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 65 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Learn About Us & Our Employee Purchase Program | Purchasing Power
Length: 65 characters
Meta Description Test96% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Purchasing Power is more than just an employee purchase program. We provide a better way to get the small, or big, things that improve your quality of life.
Length: 156 characters
Google Search Results Preview Test
Desktop version
https://www.purchasingpower.com/about-purchasing-powerLearn About Us & Our Employee Purchase Program | Purchasing PowerPurchasing Power is more than just an employee purchase program. We provide a better way to get the small, or big, things that improve your quality of life.
Mobile version
https://www.purchasingpower.com/about-purchasing-powerLearn About Us & Our Employee Purchase Program | Purchasing PowerPurchasing Power is more than just an employee purchase program. We provide a better way to get the small, or big, things that improve your quality of life.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is not using social media meta tags! While this type of meta tags don't affect what people see when they visit the webpage, they exist to provide information about it to search engines and social media platforms.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
10purchasing10power8better6financial5things
Keywords Usage Test45% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
purchasing
power
better
financial
things
Keywords Cloud Test
accessaccountappliancesarenassociationsbelievebetterbillsbnplbrandbrokersbusinesscareerscashchoicescloselycompaniescomparisonscontactcreditculturedeductiondiscountelectronicsemployersempowermentfaqsfinancialfreefurnituregivingglimpsehardworkinghavehealthhelpedhelpingjoinedjustlearnlifemattermatteredmillionneedneedednewsnumberofferoffersoptionsorganizationspathpaycheckpayrollpeoplepluspolicypowerpoweringprivacyproductsprogrampublicpurchasepurchasingregisterregisteredreservedresourcesresponsiblyreturnrightsroomsalesscoresectorserveservicesshopsitesmallstartedstartsstorystrivedsupporttermstestimonialsthingsthousandstimetirestodaytrademarktrademarkstravelwellnessworkworks
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test59% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Payroll deduction is how we do things.You are why.
H2 tags
Powering people to a better life.
Our story is your story.
Robots.txt Test99% of top 100 sites passed
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test74% of top 100 sites passed
  • This website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test25% of top 100 sites passed
  • This webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test28% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test8% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test65% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test79% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test41% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a meta charset tag but is not fully contained in the first 1024 bytes of the HTML document! The element containing the character encoding declaration must be serialized completely within the first 1024 bytes of the document, otherwise it can significantly affect load performance.
Social Media Test57% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook Twitter 
Speed optimizations
Score: 58
Failed: 8
Warnings: 2
Passed: 15
HTML Page Size Test21% of top 100 sites passed
  • The size of this webpage's HTML is 29.85 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test54% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 357 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 124.08 Kb to 29.85 Kb (76% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test66% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 14.21 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test71% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in more than 3.5 seconds! When the JavaScript code takes a long time to execute, it slows down the page performance in several ways: longer download times, main thread bottlenecks, delays of "Time To Interactive", memory leaks, etc.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
javascript
85.5 %
2.65 Mb
image
6.1 %
192.18 Kb
css
5.2 %
163.66 Kb
other
2.0 %
64.29 Kb
font
1.1 %
33.89 Kb
html
0.2 %
7.13 Kb
TOTAL
100%
3.10 Mb
Requests by content type
Content type
Percent
Requests
javascript
48.0 %
83
image
29.5 %
51
other
16.8 %
29
css
4.0 %
7
html
1.2 %
2
font
0.6 %
1
TOTAL
100%
173
Content size by domain
Domain
Percent
Size
ui.purchasingpower.com
26.8 %
849.71 Kb
googletagmanager.com
15.9 %
503.42 Kb
purchasingpower.com
9.7 %
307.19 Kb
lpcdn.lpsnmedia.net
9.0 %
284.54 Kb
assets.adobedtm.com
6.5 %
206.32 Kb
mt.purchasingpower.com
6.1 %
194.83 Kb
lptag.liveperson.net
5.4 %
170.39 Kb
edge.fullstory.com
3.0 %
94.07 Kb
connect.facebook.net
2.5 %
78.51 Kb
siteintercept.qualtrics.com
2.1 %
67.93 Kb
Other
13.1 %
414.88 Kb
TOTAL
100%
3.10 Mb
Requests by domain
Domain
Percent
Requests
purchasingpower.com
17.9 %
31
assets.adobedtm.com
9.8 %
17
siteintercept.qualtrics.com
4.6 %
8
ui.purchasingpower.com
4.0 %
7
googletagmanager.com
2.9 %
5
lpcdn.lpsnmedia.net
2.9 %
5
fonts.googleapis.com
2.3 %
4
dpm.demdex.net
2.3 %
4
d.oracleinfinity.io
2.3 %
4
rs.fullstory.com
2.3 %
4
Other
48.6 %
84
TOTAL
100%
173
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • It doesn't appear that this website is caching webpages. Cached pages serve up static html and avoid potentially time consuming queries to your database. It also helps lower server load by up to 80%. Caching most visibly benefits high traffic pages that access a database, but whose content does not change on every page view. Common caching methods include Alternative PHP Cache, Quickcache, and WP Super Cache (for Wordpress sites). Caching mechanisms also typically compress HTML, further reducing page size and load time.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test97% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test38% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test97% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test95% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test96% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test96% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test10% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test98% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.049 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.049 s

0.8 s

1.8 s

First Contentful Paint Test94% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 5.969 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

5.969 s

1.8 s

3 s

Largest Contentful Paint Test90% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 6.24 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

6.24 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img alt="Payroll deduction is how we do things. You are why..." src="/sites/default/files/0930-AboutUs-hero.jpg" class="w-100 h-auto" title="Payroll deduction is how we do things. You are why...">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.1268. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.1268

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Powering people to a better life. Since 2001, Purchasing Power has strived to b...
Html: <div align="center" id="wrapper">
Score: 0.1268
Server and security
Score: 83
Failed: 2
Warnings: 1
Passed: 7
URL Canonicalization Test97% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.purchasingpower.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
imperva.com
Subject Alternative Names (SANs)
purchasingpower.com, *.purchasingpower.com, *.purchasingpwr.com, stage-waf.purchasingpower.com, imperva.com
Not valid before
Fri, January 17o 2025, 8:17:09 am (z)
Not valid after
Wed, July 16o 2025, 8:17:09 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GlobalSign Atlas R3 DV TLS CA 2025 Q1
Intermediate certificate
Common name
GlobalSign Atlas R3 DV TLS CA 2025 Q1
Organization
GlobalSign nv-sa
Location
BE
Not valid before
Wed, October 16o 2024, 3:08:04 am (z)
Not valid after
Fri, October 16o 2026, 12:00:00 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GlobalSign
Root certificate
Common name
GlobalSign
Organization
GlobalSign
Not valid before
Wed, March 18o 2009, 10:00:00 am (z)
Not valid after
Sun, March 18o 2029, 10:00:00 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GlobalSign
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test100% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol but not all resources are served over this protocol!
See results list
HSTS Test82% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=31536000; includesubdomains; preload
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test98% of top 100 sites passed
Server: nginx/1.23.4
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test100% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test88% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 35
Failed: 3
Warnings: 0
Passed: 7
Structured Data Test53% of top 100 sites passed
Custom 404 Error Page Test67% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test98% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.purchasingpower.com/about-purchasing-power is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.purchasingpower.com/about-purchasing-power" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test95% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:mktomail.com include:spf1.purchasingpower.com include:spf-bitbucket.purchasingpower.com -all
Ads.txt Validation Test68% of top 100 sites passed
  • The request of ads.txt file has an unexpected Content-Type header: text/html. In order for this resource to be easily accessed by the DSPs and advertisers, its Content-Type header should be text/plain or text/plain; charset=utf-8.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved