seo site checkup logo
PricingFree ToolsArticles
Report generated a month ago
https://www.projectpicked.eu
Your general SEO Checkup Score
Archived
93/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 93 out of 100, which is higher than the average score of 75. Our analysis has identified 10 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
10 Failed
5 Warnings
52 Passed
Issues to fix
HIGH
H1 and H2 tags ensure better search engine visibility and ranking by providing structure and hierarchy to the content, improving readability, and providing opportunities for keyword optimization.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
HIGH
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
Serving resources (images, JS, CSS) from a CDN service, could improve website loading times, reduce bandwidth costs and increase content availability and redundancy.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 61
Failed: 3
Warnings: 3
Passed: 14
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 14 characters. While there's no target number of characters, titles should be descriptive and concise. Using a title tag with less than 20 characters is a missed opportunity since it can be difficult to fit all your targeted keywords in such a short text.
    We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: PICKED Project
Length: 14 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 132 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Advancing personalized kidney care through innovation, collaboration, and groundbreaking research. Explore the PICKED Project today!
Length: 132 characters
Google Search Results Preview Test
Desktop version
https://www.projectpicked.eu/PICKED ProjectAdvancing personalized kidney care through innovation, collaboration, and groundbreaking research. Explore the PICKED Project today!
Mobile version
https://www.projectpicked.eu/PICKED ProjectAdvancing personalized kidney care through innovation, collaboration, and groundbreaking research. Explore the PICKED Project today!
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:image
https://projectpicked.eu/wp-content/uploads/go-x/u/df99abfd-4c2d-4598-baaa-2dc23bb59eb1/image.png
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
picked
personalized
patient
research
website
Keywords Cloud Test
ablehnenacknowledgmentaddressadvancingakzeptierenapproachapproachesassessmentsbetterbioinformaticsbiomarkerscandidatescarecenteredchallengeschronicclickingcollaborationconsentconsortiumcontactcookiecookiescreatingcuttingdatenschutzeinstellungendatenschutzerklärungdedicateddetectiondiesediseasedoctoralearlyedgeeffectiveeinstellungenenhancingethicalethicseuropeeventsexpertsfocusingfundedfundingfuturefußzeilegenerationhauptseitehealthhealthcareihreindividualindividualizedinformationinitiativeinnovativeinstitutionskidneylegallifelivesmedicinemeetmehrmissionnavigationneedsnewsnoticeoderpatientpatientspavingpersonalizedpickedpolicyprivacyprojectpublicationsqualityremainsresearchresultsscientistssolutionsspringenstartsystemstailortailoredtoggletrackingtreatmenttreatmentsuniqueusingwebsitewelcomeübersetzungen
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage does not contain H1 headings! H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
Our Mission & Key Objectives
Why Chronic Kidney Disease Matters
Why Personalized Medicine?
Our Approach
Research Areas
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
  • This website has a sitemap file.
Image Alt Test78% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test29% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test27% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Speed optimizations
Score: 78
Failed: 3
Warnings: 1
Passed: 14
HTML Page Size Test23% of top 100 sites passed
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 260.67 Kb to 39.59 Kb (85% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 4.8 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage has less than 20 http requests. A higher number of http requests results in a user's browser needing to request a large number of objects from the server, which will ultimately slow down the loading of your webpage.
Content size by content type
Content type
Percent
Size
image
86.8 %
2.36 Mb
css
7.1 %
197.16 Kb
font
2.5 %
69.63 Kb
javascript
2.5 %
68.43 Kb
html
1.2 %
32.26 Kb
other
0.0 %
951 B
TOTAL
100%
2.72 Mb
Requests by content type
Content type
Percent
Requests
javascript
40.0 %
8
image
25.0 %
5
css
15.0 %
3
font
10.0 %
2
html
5.0 %
1
other
5.0 %
1
TOTAL
100%
20
Content size by domain
Domain
Percent
Size
projectpicked.eu
99.9 %
2.72 Mb
cdn.pagepulse.info
0.1 %
1.88 Kb
s.w.org
0.0 %
1.21 Kb
api.pagepulse.info
0.0 %
545 B
TOTAL
100%
2.72 Mb
Requests by domain
Domain
Percent
Requests
projectpicked.eu
85.0 %
17
cdn.pagepulse.info
5.0 %
1
s.w.org
5.0 %
1
api.pagepulse.info
5.0 %
1
TOTAL
100%
20
CDN Usage Test95% of top 100 sites passed
  • This webpage is not serving resources (images, javascript and css) from CDNs!
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test95% of top 100 sites passed
See results list
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.223 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.223 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 1.357 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

1.357 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 1.46 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

1.46 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<div style="background-image:linear-gradient(rgba(168, 218, 22..." class="section-inner section-edge18Inner" data-styled-section-id="75eb9639-4269-4a2b-aa77-1882d1875312">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0005. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0005

0.1

0.25

DOM element which contributes the most to CLS score:
Html: <div style="--margin-top:0px;--margin-bottom:16px;--margin-lef..." class="module-container-custom module-container-root">
Score: 0.0005
Server and security
Score: 95
Failed: 1
Warnings: 0
Passed: 6
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.projectpicked.eu" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.projectpicked.eu
Subject Alternative Names (SANs)
*.projectpicked.eu, projectpicked.eu
Not valid before
Thu, November 7o 2024, 12:00:00 am (z)
Not valid after
Fri, November 7o 2025, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Sectigo RSA Domain Validation Secure Server CA
Intermediate certificate
Common name
Sectigo RSA Domain Validation Secure Server CA
Organization
Sectigo Limited
Location
Salford, Greater Manchester, GB
Not valid before
Fri, November 2o 2018, 12:00:00 am (z)
Not valid after
Tue, December 31o 2030, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
Root certificate
Common name
USERTrust RSA Certification Authority
Organization
The USERTRUST Network
Location
Jersey City, New Jersey, US
Not valid before
Mon, February 1o 2010, 12:00:00 am (z)
Not valid after
Mon, January 18o 2038, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Plaintext Emails Test97% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 67
Failed: 1
Warnings: 1
Passed: 7
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.projectpicked.eu/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.projectpicked.eu/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • The robots.txt file does not use the disallow directive. This means that the whole website can be crawled by search engines.
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:_spf-eu.ionos.com ~all
Ads.txt Validation Test67% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved