seo site checkup logo
PricingFree ToolsArticles
Report generated 10 years ago
https://www.prepscholar.com/experthub/questions/66/new-psat-and-sat-scores-how-to-compare
Your general SEO Checkup Score
Archived
63/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 63 out of 100, which is below the average score of 75. However, there are 14 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
14 Failed
1 Warnings
24 Passed
Common SEO issues
Score: 50
Failed: 6
Warnings: 0
Passed: 9
Google Search Results Preview
Desktop version
https://www.prepscholar.com/experthub/questions/66/new-psat-and-sat-scores-how-to-compareNew PSAT and SAT scores - how to compare? - ExpertHub for SAT and ACTHow can you compares scores on the new PSAT with scores on the current SAT? Or on the new March 2016 SAT? The new PSAT is out of 1520, so in order to compare it to the current SAT you'll need to add 80 points and then multiply it by 1.5. For instance, if your daughter got a 1500/1520 on the PSAT you would do the following to figure out what a comparable SAT score was: (1500 + 80) x 1.
Mobile version
https://www.prepscholar.com/experthub/questions/66/new-psat-and-sat-scores-how-to-compareNew PSAT and SAT scores - how to compare? - ExpertHub for SAT and ACTHow can you compares scores on the new PSAT with scores on the current SAT? Or on the new March 2016 SAT? The new PSAT is out of 1520, so in order to compare it to the current SAT you'll need to add 80 points and then multiply it by 1.5. For instance, if your daughter got a 1500/1520 on the PSAT you would do the following to figure out what a comparable SAT score was: (1500 + 80) x 1.
Keywords Cloud
advertisingaffiliatedansweranswersanswersnewestanswersoldestanswerspopularapplicantsback/forwardbestblogboard™boldbookcachecheckcollegecollegescomparablecomparecontactcontentcurrentdetectdoesemailendorseentranceerrorexaminationfigureframefreegoodgroupshighhomeimportantinstructoritaliclaura_prepscleaguelessonlikelineloginmarchmarkdownmultiplyneedonlineorderoverqualifiedownerpartnerpennpointspolicyprepprepscholarpreventspricingproblemspsatpsat_scoresquestionsregisteredrejectrejectedrelatedreservedresultsretakereviewrightssafarisamplesat_scoressat®scorescoresscoringselectivesentencesserviceprivacysitestudentstagstermstesttimetitletopicstrademarktutoringwhat'sworkswritingyou'll●●
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Your site lacks a sitemap file. Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
SEO Friendly URL Test
  • This analyzed URL is SEO friendly but internal links on this page contain some links that are not SEO friendly.
See results list
Image Alt Test
  • Your webpage has 23 'img' tags and 12 of them are missing the required 'alt' attribute.
See full list
Inline CSS Test
  • Your webpage is using 29 inline CSS styles!
See results list
Deprecated HTML Tags
  • We found some HTML deprecated tags. Your are advised to change these old tags with equivalent tags or proper CSS rules.
Google Analytics Test
  • Congratulations! Your website is using the asynchronous version of Google Analytics tracking code.
Favicon Test
  • Your site either does't have a favicon or this has not been referenced correctly.
JS Error Checker
  • Congratulation! There is no occurrence of any severe JavaScript Errors in your web page.
Social Media Check
Speed optimizations
Score: 68
Failed: 3
Warnings: 1
Passed: 6
HTML Page Size Test
  • Congratulations! Your HTML size is 11.67 Kb and this is under the average web page size of 33 Kb.
    This leads to a faster page loading time than average.
HTML Compression/GZIP Test
  • Congratulations! Your page is successfully compressed using gzip compression on your code.
    Your HTML is compressed from 44.57 Kb to 11.67 Kb (74 % size savings). This helps ensure a faster loading web page and improved user experience.
Site Loading Speed Test
  • Your site loading time is around 13.915 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 69
  • 9 HTML Pages
  • 5 CSS Files
  • 23 JS Files
  • 32 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • It does not appear that you are caching your pages. Cached pages serve up static html and avoid potentially time consuming queries to your database. It also helps lower server load by up to 80%. Caching most visibly benefits high traffic pages that access a database, but whose content does not change on every page view. Common caching methods include Alternative PHP Cache, Quickcache, and jpcache. Caching mechanisms also typically compress HTML, further reducing page size and load time.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
Image Caching Test
  • Your site is not using expires headers for all of your images. An expires tag can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html PUBLIC &quot;-//W3C//DTD XHTML 1.0 Transitional//EN&quot; &quot;http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd&quot;>
Server and security
Score: 77
Failed: 2
Warnings: 0
Passed: 4
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
Server: nginx/1.6.2
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • We found 1 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 0
Failed: 1
Warnings: 0
Passed: 1
Media Query Responsive Test
  • Your website is not using media queries. You should consider using this technique in order to implement responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 38
Failed: 2
Warnings: 0
Passed: 3
Microdata Schema Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your webpage is using the canonical link tag. This means that your webpage is not the preferred one to use in the search results.
<link rel="canonical" href="https://www.prepscholar.com/experthub/questions/66/new-psat-and-sat-scores-how-to-compare" />
Nofollow Checker
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
Disallow Directive Checker
  • Your robots.txt file does not use the disallow directive. This means that the whole website can be crawled by search engines.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved