seo site checkup logo
PricingFree ToolsArticles
Report generated 7 months ago
https://www.mybackyardzone.com
Your general SEO Checkup Score
Archived
88/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 88 out of 100, which is higher than the average score of 75. Our analysis has identified 16 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
16 Failed
3 Warnings
43 Passed
Issues to fix
HIGH
To provide a good user experience, Google recommends that sites should aim for a Largest Contentful Paint duration of 2.5 seconds or less.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
Add descriptive and relevant "alt" attributes to all "img" tags to improve website accessibility.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
MEDIUM
Reducing the JavaScript execution time can result in faster page load times and a smoother user experience, as it allows the browser to render and display the page more quickly.
MEDIUM
JavaScript errors can impact user experience and may prevent users from viewing the page properly.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
Common SEO issues
Score: 65
Failed: 5
Warnings: 1
Passed: 16
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: My Backyard Zone-One place for your backyard shopping!
Length: 54 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Shop online for everything you need to enjoy your backyard. Pizza ovens or Fire Pits. Experience our excellent costumer service at mybzckyardzone.com.
Length: 150 characters
Google Search Results Preview Test
Desktop version
https://www.mybackyardzone.com/My Backyard Zone-One place for your backyard shopping!Shop online for everything you need to enjoy your backyard. Pizza ovens or Fire Pits. Experience our excellent costumer service at mybzckyardzone.com.
Mobile version
https://www.mybackyardzone.com/My Backyard Zone-One place for your backyard shopping!Shop online for everything you need to enjoy your backyard. Pizza ovens or Fire Pits. Experience our excellent costumer service at mybzckyardzone.com.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:site_name
My Backyard Zone
og:url
https://www.mybackyardzone.com/
og:title
My Backyard Zone-One place for your backyard shopping!
og:type
website
og:description
Shop online for everything you need to enjoy your backyard. Pizza ovens or Fire Pits. Experience our excellent costumer service at mybzckyardzone.com.
og:image
https://www.mybackyardzone.com/cdn/shop/files/transparent_leaf_4e829e9f-4bcc-4392-b29a-79bf52db15f6_1200x1200.png?v=1627292849
og:image:secure_url
https://www.mybackyardzone.com/cdn/shop/files/transparent_leaf_4e829e9f-4bcc-4392-b29a-79bf52db15f6_1200x1200.png?v=1627292849
og:image:width
1200
og:image:height
1200
og:image:alt
Social media image
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
185pizza128oven76ovens41fired40brick
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
pizza
oven
ovens
fired
brick
Keywords Cloud Test
accessoriesaccessoryalfrescoartisanavailablebackyardbakebathsbelfornobestbiblebowlsbrandsbrickbuiltbullbundlebundlescalifornocartcasacenterchicagochoosechoosingclementiclosedcolorscookcookingcountertopcurrentdetailsdifferentdiningdiscountsdooreasyelementiessentialfeaturesfierofiredforgetfornofreefuelgiftgiottogourmetguidehalohappyhelphomehomemadehybridlearnlearningmethodopenoptionsoriginaloutdoorovenovensperfectpinnacolopiombopitspizzapizzasplacepluspolitoportablepriceprofornopropanepurchasereviewssafetysalesaveshapeshopstainlessstandsteelstylestabletablestennistrailertypeviewwaterwoodworthzone
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
My Backyard Zone
H2 tags
WHILE IT'S COLD OUTSIDE, PLAN FOR A SIZZLING SPRING
Pizza Oven Deals for Sale
Italian Craftsmanship for Backyard Cooking Dreams
Your Backyard Collections
HOT DISCOUNTS ON PIZZA OVENS!
Discounts on Polito Pizza Ovens Discounts on Polito Pizza Ovens
Chicago Brick Oven Discounts Chicago Brick Oven Discounts
Pinnacolo Ovens Discounts Pinnacolo Ovens Discounts
Rossofuoco Pizza Oven
How to Cure Your Pizza Oven: A Step-by-Step Guide for Perfect Pizzas
Chicago Brick Ovens 500, 750, and 1000: A Comprehensive Comparison Guide
Best Hybrid Pizza Ovens 2025
Featured Pizza Ovens for Sale
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
  • This website has a sitemap file.
Image Alt Test78% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test29% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test75% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test27% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Speed optimizations
Score: 57
Failed: 7
Warnings: 1
Passed: 8
HTML Page Size Test23% of top 100 sites passed
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 2,771 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 839.1 Kb to 129.16 Kb (85% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 18.16 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in more than 3.5 seconds! When the JavaScript code takes a long time to execute, it slows down the page performance in several ways: longer download times, main thread bottlenecks, delays of "Time To Interactive", memory leaks, etc.
CDN Usage Test95% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test95% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.055 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.055 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 1.820 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

1.82 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 5.87 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

5.87 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<div class=" slideshow-background slid..." data-rimg="loaded" data-rimg-scale="1" data-rimg-template="//www.mybackyardzone.com/cdn/shop/files/pinnacolo_..." data-rimg-max="1800x1000" data-rimg-crop="false" style="background-size: cover; background-position: 50% 5..." data-themecolor="#111111" data-slidecolor="#ffffff">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0022. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0022

0.1

0.25

DOM element which contributes the most to CLS score:
Html: <div id="merchantwidget-iframe-wrapper" style="overflow: hidden; position: fixed; z-index: 214748...">
Score: 0.0022
Server and security
Score: 83
Failed: 1
Warnings: 0
Passed: 3
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.mybackyardzone.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
www.mybackyardzone.com
Subject Alternative Names (SANs)
www.mybackyardzone.com
Not valid before
Wed, January 29o 2025, 4:13:24 pm (z)
Not valid after
Tue, April 29o 2025, 5:13:20 pm (z)
Signature algorithm
ecdsaWithSha256
Issuer
WE1
Intermediate certificate
Common name
WE1
Organization
Google Trust Services
Location
US
Not valid before
Wed, December 13o 2023, 9:00:00 am (z)
Not valid after
Tue, February 20o 2029, 2:00:00 pm (z)
Signature algorithm
ecdsaWithSha384
Issuer
GTS Root R4
Root certificate
Common name
GTS Root R4
Organization
Google Trust Services LLC
Location
US
Not valid before
Wed, June 22o 2016, 12:00:00 am (z)
Not valid after
Sun, June 22o 2036, 12:00:00 am (z)
Signature algorithm
ecdsaWithSha384
Issuer
GTS Root R4
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HSTS Test84% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=7889238
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width,initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Advanced SEO
Score: 89
Failed: 2
Warnings: 1
Passed: 5
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.mybackyardzone.com/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.mybackyardzone.com/" rel="canonical"/>
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test67% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved