seo site checkup logo
PricingFree ToolsArticles
Report generated 3 years ago
https://www.medispaindia.in
Your general SEO Checkup Score
Archived
85/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 85 out of 100, which is higher than the average score of 75. Our analysis has identified 8 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
8 Failed
4 Warnings
57 Passed
Common SEO issues
Score: 89
Failed: 3
Warnings: 1
Passed: 21
Meta Title Test100% of top 100 sites passed
  • Congratulations! Your webpage is using a title tag
Text: Hair Transplant in Jaipur | Hair Transplant Cost in Jaipur |
Meta Description Test97% of top 100 sites passed
  • Congratulations! Your webpage is using a meta description tag
Text: Get the best Hair Transplant in Jaipur. Medispa, India's most advanced FUT, FUE hair transplant clinic in Jaipur at an affordable hair transplant cost.
Google Search Results Preview Test
Desktop version
https://www.medispaindia.inHair Transplant in Jaipur | Hair Transplant Cost in Jaipur |Get the best Hair Transplant in Jaipur. Medispa, India's most advanced FUT, FUE hair transplant clinic in Jaipur at an affordable hair transplant cost.
Mobile version
https://www.medispaindia.inHair Transplant in Jaipur | Hair Transplant Cost in Jaipur |Get the best Hair Transplant in Jaipur. Medispa, India's most advanced FUT, FUE hair transplant clinic in Jaipur at an affordable hair transplant cost.
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:type
website
og:title
Hair Transplant in Jaipur | Hair Transplant Cost in Jaipur
og:description
Get the best Hair Transplant in Jaipur. Medispa, India's most advanced FUT, FUE hair transplant clinic in Jaipur at an affordable hair transplant cost.
og:url
https://www.medispaindia.in/
og:site_name
Medispa Hair Transplant Clinic
og:image
https://ik.imagekit.io/yvdojrlyfj/wp-content/uploads/2019/03/hair-transplant-india-medispa.png
og:image:secure_url
https://ik.imagekit.io/yvdojrlyfj/wp-content/uploads/2019/03/hair-transplant-india-medispa.png
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
177hair142transplant39medispa32jaipur25suneet
Keywords Usage Test81% of top 100 sites passed
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
absolutelyaccommodationadvancedaestheticaffordableappearanceartisticbaldbeardbestcalculatorcelebritiescelebritycenterchooseclassclinicclinicscombineconfidenceconfidentconsultationcontactcorrectioncosmeticcostdaysdelhidensitydependsdoctordubaiexpertiseeyebrowfemalegloballygraftgraftshairhairlinehappyhavehighlyimportantindiainfoinformationinternationaljaipurkotalaserlearnlooklookinglossmalemedispamedispaindiamembermumbaimustachenaturalnorwoodonlinepatientpatientspeopleperformedperformingpermanentplasticprocedureprovideprovidedprovidingrajasthanrestorationresultresultsscalpsenseservicessharesitesmilesonisuccessfulsufferingsuneetsurgeonsurgeryteamtechniquetechniquesthankstrainingtransplanttreatmentworldwrong
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • Congratulations! Your webpage contains headings tags.
H1 tags
Medispa - Best Hair Transplant in Jaipur
H2 tags
Hair Transplant Cost & Graft Calculator
Hair Transplant Result
Hair Transplant Video
Medispa's Specialty
About Dr. Suneet Soni
Celebrity Hair Transplant
FUT + FUE + BHT Combine
Hair Transplant in Jaipur
Our Hair Transplant Services
Hair Transplant Reviews & Testimonial
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
  • Congratulations! Your website has a sitemap file.
SEO Friendly URL Test40% of top 100 sites passed
  • Congratulations! All links from your webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • Your webpage is using "img" tags with empty or missing "alt" attribute.
See full list
Responsive Image Test38% of top 100 sites passed
  • All images in this page are properly sized for different users' viewports.
Image Aspect Ratio Test72% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test2% of top 100 sites passed
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • We've found JavaScript errors on your webpage!
See results list
Console Errors Test33% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
meta charset="UTF-8"
Social Media Test80% of top 100 sites passed
  • Congratulations! Your website is connected successfully with social media using:
Facebook Pinterest Twitter 
Speed optimizations
Score: 75
Failed: 5
Warnings: 1
Passed: 16
HTML Page Size Test34% of top 100 sites passed
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 2,277 nodes which is greater than the recommended value of 1,500 nodes. A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 164.61 Kb to 34.54 Kb (79% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • Your website loading time is around 1.08 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Content size by content type
Content type
Percent
Size
javascript
47.4 %
311.70 Kb
image
44.2 %
290.88 Kb
html
8.1 %
53.32 Kb
other
0.3 %
2.15 Kb
css
0.0 %
0 B
font
0.0 %
0 B
TOTAL
100%
658.06 Kb
Requests by content type
Content type
Percent
Requests
image
56.3 %
36
javascript
31.3 %
20
other
9.4 %
6
html
3.1 %
2
css
0.0 %
0
font
0.0 %
0
TOTAL
100%
64
Content size by domain
Domain
Percent
Size
ik.imagekit.io
44.1 %
290.21 Kb
embed.tawk.to
20.3 %
133.46 Kb
medispaindia.in
18.7 %
123.38 Kb
googletagmanager.com
8.2 %
54.21 Kb
google-analytics.com
3.1 %
20.11 Kb
stats.g.doubleclick.net
2.6 %
17.18 Kb
googleadservices.com
2.3 %
15.31 Kb
googleads.g.doubleclick.net
0.3 %
1.66 Kb
va.tawk.to
0.2 %
1.56 Kb
google.com
0.1 %
628 B
Other
0.1 %
366 B
TOTAL
100%
658.06 Kb
Requests by domain
Domain
Percent
Requests
ik.imagekit.io
50.0 %
32
medispaindia.in
12.5 %
8
embed.tawk.to
12.5 %
8
stats.g.doubleclick.net
6.3 %
4
google-analytics.com
4.7 %
3
google.com
4.7 %
3
va.tawk.to
3.1 %
2
googletagmanager.com
1.6 %
1
googleadservices.com
1.6 %
1
googleads.g.doubleclick.net
1.6 %
1
Other
1.6 %
1
TOTAL
100%
64
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • Your webpage is not serving all resources (images, javascript and css) from CDNs.
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Caching Test99% of top 100 sites passed
  • Your webpage is not using uncached images from your domain.
JavaScript Caching Test98% of top 100 sites passed
  • Congratulations! Your website is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • Your webpage is not using uncached CSS resources from your domain.
JavaScript Minification Test93% of top 100 sites passed
  • Congratulations! Your website's JavaScript files are minified!
See results list
CSS Minification Test97% of top 100 sites passed
  • Your webpage is not using CSS resources from the same domain.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help your page load significantly faster and improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • Congratulations! Your webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 0.56 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

0.56 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img src="https://ik.imagekit.io/yvdojrlyfj/wp-content/theme..." loading="lazy" class="header-main-img" alt="hair transplant in Jaipur" title="hair transplant in Jaipur">
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.592. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.

0.5922

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Medispa - Best Hair Transplant in Jaipur MEDISPA Hair Transplant is one of the ...
Html: <aside class="wrapper blue">
Score: 0.5568
Server and security
Score: 96
Failed: 0
Warnings: 1
Passed: 8
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • Your website is successfully using the HTTPS protocol, but the SSL Certificate will expire in less than a month! Having an up-to-date certificate is an important security practice to ensure that your website is safe and provides trust, and any communication between the user's browser and your website (such as passwords, credit cards, or forms) is encrypted and private.

The certificate is not used before the activation date.

The certificate will expire in less than a month!

The hostname "www.medispaindia.in" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
medispaindia.in
Subject Alternative Names (SANs)
medispaindia.in, www.medispaindia.in
Not valid before
Thu, July 29o 2021, 12:00:00 am (z)
Not valid after
Fri, July 29o 2022, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Sectigo RSA Domain Validation Secure Server CA
Intermediate certificate
Common name
Sectigo RSA Domain Validation Secure Server CA
Organization
Sectigo Limited
Location
Salford, Greater Manchester, GB
Not valid before
Fri, November 2o 2018, 12:00:00 am (z)
Not valid after
Tue, December 31o 2030, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
Root certificate
Common name
USERTrust RSA Certification Authority
Organization
The USERTRUST Network
Location
Jersey City, New Jersey, US
Not valid before
Mon, February 1o 2010, 12:00:00 am (z)
Not valid after
Mon, January 18o 2038, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • Congratulations, this webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
Safe Browsing Test100% of top 100 sites passed
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • Congratulations, your server signature is off.
Directory Browsing Test100% of top 100 sites passed
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test93% of top 100 sites passed
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1, shrink-to-fit=no" />
Media Query Responsive Test99% of top 100 sites passed
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 98
Failed: 0
Warnings: 1
Passed: 9
Structured Data Test59% of top 100 sites passed
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Custom 404 Error Page Test75% of top 100 sites passed
  • Congratulations, your website is using a custom 404 error page. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test99% of top 100 sites passed
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://www.medispaindia.in is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.medispaindia.in/" rel="canonical"/>
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
Meta Refresh Test95% of top 100 sites passed
  • Congratulations, this webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 +a +mx +ip4:50.116.93.199 +include:websitewelcome.com ~all
Ads.txt Validation Test80% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved